KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0753Help
Entry
Cbei_0753         CDS       T00547                                 

Definition
(GenBank) hypothetical protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Halogen_Hydrol DUF2207 GP24_25 IF2_N DUF485 V-ATPase_G_2 ApoLp-III
Motif
Other DBs
NCBI-ProteinID: ABR32937
UniProt: A6LRF7
Position
910856..912055
Genome map
AA seq 399 aa AA seqDB search
MDKKDFSNLENQIRDTIKNAFDVIDFAKIKKDIDDKAQETVRETRNKFVDKSQYFDKKIK
DELKNRYKNIANVVPKSENKIQKYIAKRPVGSISGTLYTIFGSILSGILGILIISYSILI
SFKSEFLMSNLISLGILFSFLAASGAFTLRGINLRKRAKRFKEYVKLLRGNSYCSISELA
EAVRKKNKFVVKDLRKMIELNMFPQGHIDDKQTYFMLNNKVYENYLTSQESLKKRNEDEL
KKQEELKKDFNDPVKMELRNTIEMGRDYIKQIGDISSSIDKEEISKKLNRLQNIINQILK
YVEQNPKKLQEVDRFAKHYLPMTLKLLNAYKELNEQPVQGDNIRNAKNEIEKTLDTINNA
FEKLLDDLFEEIALDISTDISVLETLFTQEGLKKDDFKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagatttttctaatttagaaaatcaaattagagatacaataaaaaatgca
ttcgatgtcatagattttgctaagataaaaaaagatattgatgataaagctcaagaaact
gttagagagacaagaaataaatttgtagataaatcacagtattttgataaaaagataaaa
gatgaattaaaaaatagatataaaaatatcgcgaatgttgttccaaaatctgaaaataaa
atacagaaatatattgctaagagaccagttggaagtatatcaggaacattgtatacaata
tttggatctatattaagcggaatattaggaatattaataatttcatattcaatacttatt
tcttttaagagtgaatttttaatgagtaatttgattagcttaggaatattgttttctttt
cttgcggcgagtggagcttttactttaaggggtataaatttaagaaagagagcgaagcgt
tttaaagaatatgtgaaattgctacgaggtaatagctattgctccattagtgaattagct
gaggctgttaggaaaaaaaataaatttgtagttaaagatttaagaaaaatgattgaatta
aatatgtttccacaaggacatattgatgataagcagacttatttcatgttaaataataaa
gtttatgagaattatttgacttcacaggaatctttgaagaaaaggaatgaagatgaatta
aaaaaacaagaggagctaaaaaaagacttcaatgatccagtgaagatggaactaaggaat
acaattgaaatgggaagggattacattaaacaaataggagacataagtagttctatagat
aaagaagaaatttctaaaaaattaaataggctccagaatattataaatcaaatacttaag
tatgttgagcagaatcctaaaaagcttcaagaagttgatagatttgcaaaacactatctg
cctatgactttaaagcttcttaatgcatataaagaattgaatgagcagccggttcagggt
gataatataagaaatgcaaaaaatgaaattgaaaagactttggataccataaataatgca
tttgaaaagttattagacgatttatttgaagaaatagcattagatatttctacagatatt
tctgttcttgaaacactatttactcaagaagggcttaaaaaagatgatttcaaaaaatag

DBGET integrated database retrieval system