KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0755Help
Entry
Cbei_0755         CDS       T00547                                 

Definition
(GenBank) putative CheW protein
  KO
K03415  two-component system, chemotaxis family, chemotaxis protein CheV
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe02020  Two-component system
cbe02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cbei_0755
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Cbei_0755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cbe02022]
    Cbei_0755
   02035 Bacterial motility proteins [BR:cbe02035]
    Cbei_0755
Two-component system [BR:cbe02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cbei_0755
Bacterial motility proteins [BR:cbe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cbei_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW Response_reg
Motif
Other DBs
NCBI-ProteinID: ABR32939
UniProt: A6LRF9
Position
913563..914462
Genome map
AA seq 299 aa AA seqDB search
MNNNILLESGTGELEIIEFIANGNHYAINVVKVKEVIEMPSNLTKLPDPKPEIAGLILCR
DEILTLIDLKYILTKRSAGKLGSKVIVCEFNKIKVSFNIDDIVGVHRIRWDEIRKPDDLS
ENSLAVGNILLNGKVLIMLDFEKIVTDICPSVGISEDRLIQVDYKDRSSIKLVMADDSAL
IRRLLKDTLTKAGFKNLRIFDDGKQALDFFEELARNKGEKFIEEAQLLITDIEMPQMDGL
TLTRKIKENETLKKLPVVIFSSLITGELKHKGESVGANAQLSKPEVSDLVDTIDKLLGV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacatattactagaatcgggtactggggaattagaaataatagaatttatc
gcaaatggaaatcattatgcaattaatgttgtaaaagttaaagaggtaatagagatgcct
tcaaacttaactaaattgccagatcctaagccagagatagctggcctcatactatgcaga
gatgagatacttactttgattgatttaaaatacatattaacaaaaagatcggcaggaaaa
cttggatccaaggttatagtttgtgagtttaataaaataaaagtttcatttaatattgat
gatatagttggagttcatcgtataagatgggatgaaataagaaaacctgatgatctatca
gaaaactcattagctgttggaaatatacttttaaatggaaaagtattaattatgcttgat
tttgaaaaaatagtgacagatatttgtccaagtgttggaataagtgaagatagacttata
caagtagattataaagatagatcatctataaaattagttatggctgatgattctgcttta
attagaaggttattaaaagatactcttacaaaagcaggatttaagaatttaagaattttt
gatgacggtaaacaagcgttagatttcttcgaagaattagcaagaaataaaggtgaaaaa
tttattgaagaagctcaattacttattacagatatagaaatgcctcagatggatgggctc
acattgacaagaaaaataaaagaaaatgaaacattgaaaaagcttcctgttgtaatattt
tcatcactaattacgggagaattaaaacataagggagaatcagtgggagcaaatgcacag
ctaagtaagccagaagtaagtgatcttgttgatacaatagacaaactattaggtgtttag

DBGET integrated database retrieval system