KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0757Help
Entry
Cbei_0757         CDS       T00547                                 

Definition
(GenBank) secreted protein containing uncharacterized conserved protein of ErfK family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PG_binding_4 YkuD Poly_export
Motif
Other DBs
NCBI-ProteinID: ABR32941
UniProt: A6LRG1
Position
916542..917924
Genome map
AA seq 460 aa AA seqDB search
MIKQILQYIKYPKRIMMIICALVAIYSIVSIHFINHFYFGSTINRVDVSGKTVQEAEEEI
LSKMDTYSVELEERYGAREEIKGGDINLRYDLGDKIKELKSKQISFAWILSFLGEKNYTI
TDSVSYNEDLLKKSFNNLSCITGSSVVAPKNPELEYKDDGYIINKEIYGNKINKDALYEH
LIKAIVSGEKKINLESINCYENPKYISTSKEVLEAKNILDKYASSKITYSFGEDNEVIDG
SVIHNWLKVDQDYSVAIDEKKVYEYMKKIANTYNTSGKTRDFKTSLGTITKVSGGNYGWV
IDTSQEAKELIKDIGKGENIAKEPIYKQVALSHDSNDIGNTYVEINMNIQHLWYYKNGIL
VIEGDVVTGNASRGSPTPTGVYRLNYKQKDATLKGENYSSSVSFWMPFYGNVGIHDASWR
SEFGGNIYKANGSHGCVNAPYYLAKVLFNNIEEGTPIVCY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaaatattacaatacataaaatatccaaaaagaataatgatgattatttgt
gccctggtagctatatattcaatagtttctatacattttatcaatcatttttattttggt
tcaacaattaacagagttgacgtctcaggtaaaacagtgcaagaggcagaagaagaaata
ttatctaaaatggacacatattcagtggaattagaagaacgttatggtgcaagggaagaa
ataaaaggaggggatattaacttaagatatgatttaggagacaaaattaaagaactgaaa
agtaagcagatttcatttgcttggattttatcttttttaggagagaagaattatacaatt
acggattctgtatcatataacgaagatttattaaagaaaagctttaataatctttcttgt
ataacaggaagcagtgtagtggcacctaaaaatcctgaattagaatataaagatgatgga
tatataattaacaaagagatatatggaaataagattaataaagatgctttgtatgaacac
ttaataaaggcaattgttagtggggagaagaaaattaatttagaatcaattaattgctat
gagaatcctaagtatatatcaacatctaaggaagttttagaagctaaaaatatactcgat
aaatatgcatcatcaaaaattacatattccttcggcgaagataatgaagttattgatgga
tcagtaatacacaattggcttaaagtagatcaagattattctgttgcaattgatgaaaaa
aaagtctatgagtatatgaaaaaaattgctaatacgtataatacctcaggaaaaacaaga
gatttcaaaacatctttaggaacaataacaaaagttagtggaggaaattatggatgggta
attgatacttcacaggaagcaaaagagttgattaaagatattgggaaaggagagaatata
gcaaaagagcctatatataagcaagttgctttatctcatgatagtaatgacataggcaat
acttatgtggaaattaatatgaatattcaacacttatggtattacaaaaatggaatactt
gtaatagaaggtgatgttgttacaggtaatgcaagcagaggctctccgactccaactgga
gtttatcgattaaattataagcaaaaggatgctaccttgaaaggtgaaaattatagtagc
tctgtttctttctggatgcctttttatgggaatgttggtatacatgatgcaagctggaga
tcagagtttggtggaaacatatacaaagcgaacggttctcatggatgcgttaatgcacca
tattacctagcaaaggtcttatttaataatattgaagaaggtactccgatagtttgctat
tag

DBGET integrated database retrieval system