KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0760Help
Entry
Cbei_0760         CDS       T00547                                 

Definition
(GenBank) membrane spanning protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECF-ribofla_trS ECF_trnsprt
Motif
Other DBs
NCBI-ProteinID: ABR32944
UniProt: A6LRG4
Position
920020..920553
Genome map
AA seq 177 aa AA seqDB search
MEINRRKSKFKTKDMVETALLTALVFVATAFINIRLPILATGGLVHLGTVMLFVTAIVFG
KEKGAIAAAVGMAIFDLSSGWALWAPFTFIVRGIMGYMVGAIAWSRNEEGNSIILNLLAI
ILSGIWMIIGYYITEGILYGNWASPVASIPGNVTQIVIGLLLGLPIAKVLRRYKKYI
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaacagaagaaaaagcaaatttaaaacaaaagacatggtagaaacagcacta
ttgacagcgctagtatttgttgcaacagcgtttataaatattagattgccgatattagct
actggcggattggttcatttaggaactgtaatgttatttgttacagcaattgtttttgga
aaagagaagggtgctatagctgctgctgtaggaatggcaatatttgatttatcatcagga
tgggcgctttgggctccatttacatttatagtaagaggaattatgggatatatggttggt
gccatagcgtggagtagaaatgaagaaggtaatagtatcatacttaatcttttagcaatt
atcttatcaggtatttggatgataatcggatactacattactgaaggaatactttatgga
aactgggcatcaccagttgcatcaatacctggaaatgtgactcagattgttattggatta
ttgcttggattgcctattgctaaggtacttagaagatataaaaagtatatttaa

DBGET integrated database retrieval system