KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0761Help
Entry
Cbei_0761         CDS       T00547                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00030  Pentose phosphate pathway
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
cbe01230  Biosynthesis of amino acids
Module
cbe_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
cbe_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cbei_0761
Enzymes [BR:cbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Cbei_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind CoA_trans DUF3726
Motif
Other DBs
NCBI-ProteinID: ABR32945
UniProt: A6LRG5
Position
920740..921420
Genome map
AA seq 226 aa AA seqDB search
MSDNDLKKNSAKEAMKYIKDGMIVGLGGGRSIAYLIEFIKQDKNINVKIVTPSVKTKMLC
IEKGLEVLYTSSVDKVDVAFDGCDQVDEKLNALKSGGGIHTKEKLIASMAEEYILLVDEA
KVEKELTFNVPVVLEVLEDSLKYVEKKVLELNGKPVIRSSDIKDGFTISDNGNLLVDVFF
NNVKDIHKLNDNLIRICGVIETSLFTNVITKVIIASKEGIREISQK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataacgatttaaagaaaaatagtgctaaggaagccatgaaatatataaaagat
gggatgatagtaggtctaggtggagggcggagcatagcttatttaatagaatttataaaa
caggacaaaaatattaacgtaaagatagttactccttcagtgaaaacaaagatgctttgt
atagaaaaaggtttagaagttttgtacacaagttctgtggataaagtggacgttgctttt
gatggctgtgaccaagttgatgaaaaattaaatgcattgaaaagtggtggaggaattcat
actaaggaaaagttaattgctagtatggcggaagaatatatccttcttgttgatgaggca
aaagttgaaaaagagttaacatttaatgttccggtagtacttgaagttttagaggattct
ttgaagtatgttgaaaaaaaagtactagaattaaatgggaaaccagtgattagaagtagc
gatataaaagatggatttactataagtgataatggcaacctattagtagatgtattcttt
aataatgtaaaagatattcataaactaaatgataatctaataagaatttgtggagttata
gaaacgtcattatttactaatgtaatcacaaaagtgattattgctagtaaggaaggtatt
agggaaatttcacaaaaataa

DBGET integrated database retrieval system