KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0762Help
Entry
Cbei_0762         CDS       T00547                                 

Definition
(GenBank) oxidoreductase domain protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA F420_oxidored Shikimate_DH NAD_binding_3 2-Hacid_dh_C GFO_IDH_MocA_C
Motif
Other DBs
NCBI-ProteinID: ABR32946
UniProt: A6LRG6
Position
921468..922436
Genome map
AA seq 322 aa AA seqDB search
MNKINWAVLGPGTIAADFAKAINEVNGKIYAVGSRNIEKARDFANKYNIEKAYGDYDEML
KDDNIDVVYIATPHCNHYEYIIKSLNNNKNVFCEKAITVNGKQLKEIVELANEKKLIVAE
AMTIYHMPLYKKLRKIVDDGKLGKIKMIQVNFGSLKEYDVTNRFFSPDLAGGALLDIGTY
ALSFTRYFLSSQPEEILTTVKKFETGVDEQSGIILKNSDDEMAVISLTMRAKQPKRGIVC
GELGYITVENFPRADKATITYPDGSVEIIEEGHGSKALEYEIECVNSMVMSKTGNDTLRL
SVDVMDIMDEVRKQWNLSYTFE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataaattgggcagtactagggccaggaacaattgcagcagattttgcaaag
gccataaatgaagtgaatgggaagatatatgcggtaggttcaagaaatattgaaaaggca
agggattttgctaataaatataacatagaaaaagcttacggagattatgatgagatgcta
aaagatgataatatagatgtcgtttatatagcgacgcctcactgtaatcattatgaatat
ataattaagagtcttaataataataaaaacgtattttgtgaaaaagcaattactgtaaat
ggaaagcaattgaaagaaatagttgaattagcaaatgagaaaaaattaatagtggcagaa
gcaatgactatttatcatatgccgttatataaaaagttacgtaaaattgttgatgatggc
aagcttggaaagattaaaatgattcaagttaactttggaagccttaaagagtatgatgtg
acaaatagattttttagcccagatttagcaggaggtgcccttcttgatataggaacatat
gcattgtcatttacaaggtactttctctctagtcagccagaggaaattttaactacagtt
aagaaattcgaaactggagtggatgagcagtcaggtataattcttaaaaattctgatgat
gaaatggcagttatatcattaactatgagagcaaaacagccaaagagaggaattgtatgt
ggagaattaggatatataactgttgaaaattttccaagagcagataaagcaacaattaca
tatcctgatggaagtgtagaaattattgaagaaggccatggttcaaaagcattagaatat
gaaattgaatgcgtaaatagtatggtaatgagtaaaacaggtaatgatactttaagattg
tctgttgatgtcatggatataatggatgaggtaaggaaacaatggaatttaagctatact
tttgagtaa

DBGET integrated database retrieval system