KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0763Help
Entry
Cbei_0763         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, RpiR family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 DUF4380
Motif
Other DBs
NCBI-ProteinID: ABR32947
UniProt: A6LRG7
Position
922467..923342
Genome map
AA seq 291 aa AA seqDB search
MIKGVIIKVREIEKSVLDKILCIYKSLHEAEKKIADYIINNKERVIEMTVSELALESSVS
EATIVRFCKKCDLKGFYDLKIKIAKEMVNLKSSNISNELDSNNIMQSLQNILANKIEELK
QTISMMNEGNIKRILEAIKGARIVQFAAVGNTIPVAMDGAYKFNQLGISSVTNTIWETQL
AFSYTLTKEDVVIVISNSGASKELVALLEIANERQATTISITNHENSPVANKSKYHINTS
TREKLFLDEFSFSRVSAMVVIEILYLLLTRDKEDAYNWISQHEQSIAEGKI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaagggagtaattattaaagtgagagagatagaaaagagtgttctagataaaatt
ctttgcatttataaaagcttacatgaagcagaaaaaaagattgctgattatataattaat
aataaagaaagagtcattgaaatgactgtttctgagttagcattagaaagtagtgttagt
gaagctacaatagttaggttctgtaaaaaatgtgatttaaaaggtttttatgatttgaaa
attaaaatagctaaagaaatggttaatttaaaaagtagtaatatatcaaatgaattagat
tccaataatataatgcaatcacttcaaaatatattagcaaataaaattgaagaattgaaa
caaacaatttcaatgatgaatgaaggtaatataaaaagaatattagaagcaattaaagga
gcgagaattgttcaatttgcagcggttggtaatacaatacctgtagcaatggatggagca
tataagtttaaccagttgggaatatcatctgttactaataccatatgggaaacacaactt
gcattttcatatactttaactaaagaagatgtagttatagtgatatctaattcaggagct
tcaaaagagcttgtagctttacttgaaattgctaatgaaagacaggcaacaactatttct
ataactaatcatgagaattctcctgttgccaacaaaagcaaatatcatataaatacttca
acaagagagaaactatttctagatgagtttagcttttctagagtatcggctatggttgtt
atagaaatcttatacttacttttaacaagggataaagaagatgcatataattggattagt
cagcacgaacaatctattgcagaaggaaagatataa

DBGET integrated database retrieval system