KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0764Help
Entry
Cbei_0764         CDS       T00547                                 

Definition
(GenBank) aldo/keto reductase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red DnaJ
Motif
Other DBs
NCBI-ProteinID: ABR32948
UniProt: A6LRG8
Position
923428..924348
Genome map
AA seq 306 aa AA seqDB search
MKNINIGNSEIKASEIGLGCMRMASVEKSEAEKIIKTSLEEGINFFDHADIYGGGKSEEV
FADAIKMDSSIREKMIIQTKCSIVPGIMYDFSKEHILNSVDASLKRLKTDYVDTLLLHRP
DTLMEPEEVAEAFSKLHESGKVKYFGVSNHTPMQIELLNKYLNNKIIINQLQFSIMHTGM
IDAGLNMNIKNDASIDRDGGVLEYCRLKDITIQAWSPYQYGFFEGVFLDNDKFPELNKKI
NAIAEKYAVTNTAIATAWILRHPAKIQTIVGSMNAERIKEICKASNITLTRQEWYEIYLA
AGNKLP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatataaatattgggaatagcgaaatcaaagcttctgaaattggacttggatgc
atgcgaatggcatcagttgaaaagagcgaggcggaaaagatcatcaagacgtcgttagaa
gaaggaattaatttctttgatcatgctgatatatatgggggaggaaaatcagaagaagtt
tttgcagatgcaattaaaatggattcttccataagagaaaaaatgatcattcagactaag
tgttctatagtaccaggaataatgtatgatttttcaaaagaacatatcttaaattcagta
gatgctagtttaaagagattaaaaacagattatgtagatacattactgctacaccgtcca
gatacgcttatggaacctgaagaagttgcagaagctttttctaaattacacgaaagcggg
aaagtaaaatattttggagtgagtaaccatactccaatgcaaatagaattacttaacaaa
tatttgaataacaaaataattataaatcaattgcaatttagtataatgcatacaggaatg
atagatgcaggattaaacatgaatatcaaaaatgatgcttctatagatagagatggggga
gtattagaatattgccgtcttaaagatataactattcaagcatggtctccttatcaatat
ggattctttgaaggcgtattcttagataatgacaaattcccagaattaaataagaagatt
aatgcaatagcagaaaagtacgcagtaactaatactgcaattgcaactgcatggatatta
aggcatccagcaaagatacaaacaatagttggatctatgaatgctgaacgaataaaagaa
atatgtaaagcatcaaatatcacattgactagacaagaatggtatgaaatatatctagca
gcaggaaacaaattaccataa

DBGET integrated database retrieval system