KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1286Help
Entry
Cbei_1286         CDS       T00547                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00860  Porphyrin and chlorophyll metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
Module
cbe_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cbei_1286
Enzymes [BR:cbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cbei_1286
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cbei_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ABR33466
UniProt: A6LSY6
Position
1519796..1521259
Genome map
AA seq 487 aa AA seqDB search
MSKVYIIGTGPGDEELLTLKAVKVLKRCTAVLYDRLVSNNVLNYLEPNCEIYYCGKEPGA
HSKTQEEINELLVKLAKEGHTVGRIKGGDPYVFGRGGEEVLALVDENIEFEVIPGVTSPI
AVLNYAGIPITHRKIAQSFHVITGKSAQDLNVNFKALAKEEGTLVFMMGLGNLDNIVEEL
INNGKEPIFPCAVVMRGTSAKQKKVVGTLENISQKVKDAKLQSPCIIVVGEVVNLNKDLN
WYENKPLFGKNICITRSRRQSEKLKNKLVDLGAEVTSFNSIKIESSAENLNDYIEKIENY
DHMVFTSVNSVEIFFDYLIEKDYDIRRIKAKISAIGAATANSLKQRGIICFAKAREFVGE
GLVSILKPHLKDNQTLLLPCSAKSRKYIYEELTNCGASVDKVYIYDTVCGSVVNKRSFDE
VDIVFFTSPSTVENMIDMLGIEEIKKKQVIAIGPKTNEPLEKYGIKAYVCKEHSEEGFLK
EIENLLQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtatatataataggtacaggtccaggagatgaagagttattaacattaaag
gctgtcaaggtattaaaaagatgtactgctgttctttatgatagattggtttcaaataat
gttttgaattatctagaaccaaattgtgaaatttattattgtggaaaggaaccaggagct
cattcaaaaactcaagaggagattaatgaacttttagttaaacttgcaaaagaagggcat
acagttggaagaattaaaggtggagacccatatgtttttggaagaggcggagaagaggta
ttggctttagttgatgaaaatatagaatttgaggtaataccaggggtaacatctcctatt
gcagttttaaattatgcaggaatcccaataactcacagaaagatagcacaaagttttcat
gttataacaggaaaatctgcgcaagatttaaatgtgaattttaaggctctagctaaagaa
gaaggcacattagtatttatgatgggattaggcaatttagataatatagtggaggagctt
attaataatggaaaagaaccaattttcccatgtgcggtagtgatgagaggaacttcagct
aagcaaaaaaaggtagtaggaacgcttgagaatatttcacaaaaagtaaaagatgctaaa
ttacaatctccatgtataattgttgttggtgaagttgtaaatttaaataaagatttgaac
tggtatgaaaataaacctttgtttggaaagaatatatgtattacaagatcaaggagacaa
tctgagaaattaaaaaataaattagttgacttaggagcggaagttacaagttttaattct
attaagatagaaagcagtgcggaaaacttaaatgattatatagagaagatagaaaattat
gatcatatggtatttacttcagttaatagtgtagaaatattttttgattatcttattgaa
aaagattatgatataagaagaattaaagctaaaatatccgcaataggcgctgctactgca
aattctttaaaacaaagaggaattatctgttttgcaaaggccagagaatttgttggtgaa
ggtttagtgagcatattaaaacctcatttgaaagataaccaaactctacttttgccgtgt
tctgcaaaaagtaggaaatatatttatgaagaactaacaaattgtggtgcaagtgtagat
aaagtatatatatatgatacggtttgtggatcagtagttaataagagatcttttgatgaa
gttgacatagtattcttcacaagtccgtcaacagttgaaaacatgattgatatgttaggg
attgaggaaattaagaaaaagcaggttatagctataggaccaaagactaatgaaccttta
gaaaagtacggaataaaagcatacgtatgtaaagaacactcagaggaagggtttctgaaa
gagatagaaaatttactgcaatag

DBGET integrated database retrieval system