KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_3185Help
Entry
Cbei_3185         CDS       T00547                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00450  Selenocompound metabolism
cbe00970  Aminoacyl-tRNA biosynthesis
cbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cbei_3185
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cbei_3185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbe01007]
    Cbei_3185
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbe03016]
    Cbei_3185
Enzymes [BR:cbe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Cbei_3185
Amino acid related enzymes [BR:cbe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cbei_3185
Transfer RNA biogenesis [BR:cbe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cbei_3185
 Prokaryotic type
   Other AARSs
    Cbei_3185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 DUF2481
Motif
Other DBs
NCBI-ProteinID: ABR35315
UniProt: A6LY85
Position
complement(3720401..3722368)
Genome map
AA seq 655 aa AA seqDB search
MISKRIEKNERPTFPKKAIVTAGMPYGNKNLHFGHVGGMFIHADIFARFLRDRIGKENVI
FVSGTDCYGSPILESYRKLKENGYENTMEDYVKANHLSQKKTLEDYNISLNIFGASALGR
TGEFHNEVSEEIFNTLFKNGYIKKMSALQFYDEDKKIFLNGRQVIGKCPIAGCNSDKAYA
EECSLGHQYMASELINPISTLSGNKPILKSVDNWYFTLDESMDIMKELNEFLKKNTNRRK
YEINTIDEFLKKPLIYVPRKYIKDVNDLEAKFPSHETIDEEKKSSLAFIFQTLEDRDKAK
EILDNLNINYTSGKTLVPFRLSGNIEWGVKVPDKEYLKNLTFWVWPESLWAPISFTKAYL
ESRGKNPEEWRNWWDNDDSIVYQFIGEDNIYFYSIAEMAMFIGLKMPKGENVDVTKLNLP
HIVSNKHILFMDKKASSSSDIKPPMADELLKFYTKDQLRMHFMSLGLSSKSVGFKPQVYM
KEEEKVGADPVLKEGNLLTNVFNRLIRSCFYTLQSLNEDIPKEDVSEKIKELTEKSVLEY
ERHMYNQDFHRIAYVLDDYIREVNKHWASNIKNEELKRNVIADCFYACKVIAVLIHPIAP
EGCEMFKDYLNIDDELWNWDKIFEPITSYFEDAKSHKFKFLEPKVDFFKKMEYQY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaaaagaatagaaaaaaacgaaagaccgacatttccaaagaaggctatagta
acagctggaatgccttatggaaataagaatcttcattttggccatgttggaggaatgttc
atccatgcagatatattcgcaagatttttaagagatagaatagggaaagaaaatgttatt
tttgtatctggtacagattgttatggttcacctatccttgaaagctacagaaagctaaag
gaaaatggatacgaaaatactatggaggactatgttaaggcaaatcatttgagtcaaaag
aaaaccttagaagattacaatatcagcctaaatatttttggagcttcagcccttggaagg
acaggagaatttcataatgaagtttcagaagaaatatttaatactttattcaaaaatggt
tatataaagaagatgtcagcactgcaattttatgatgaagataagaaaatctttcttaat
ggaaggcaagtaataggaaaatgtccgatagccggatgtaactctgataaagcctatgca
gaagaatgttcattagggcatcaatatatggcatctgaattaattaatcctattagcact
ttatcaggaaataaaccaatattaaaaagtgtagataattggtattttaccttagatgaa
tccatggatataatgaaggagcttaatgagtttttaaagaagaatactaatagacgaaag
tatgaaattaacactatagatgaatttttaaagaagccattaatatatgtcccaagaaaa
tatataaaggatgtaaatgatctagaagctaaatttccaagccatgaaaccatagatgaa
gagaaaaaatcttcactagcgtttattttccaaacactagaggacagggataaagcaaaa
gaaatattggataatttaaatattaactatactagtggtaagacattggttccttttaga
ttatcaggaaatatagagtggggagtaaaagtaccagataaagaatatttaaaaaattta
accttctgggtgtggccagaatctttatgggctccaatttcttttacaaaagcgtatttg
gagtcaagaggtaagaatcctgaagaatggcgtaattggtgggataatgatgattcaata
gtatatcaatttataggggaagataatatatatttttattcaattgctgaaatggccatg
tttattggcttaaagatgcctaagggtgaaaatgtagatgttactaagttaaatttgcca
catattgtttctaataagcacattttatttatggataaaaaagcaagcagcagttcagat
attaagccaccaatggcagatgaattattgaaattttatacgaaggatcaattacgcatg
cactttatgagtcttggattatcttcaaaaagtgttggttttaaaccacaagtttacatg
aaggaagaagaaaaagtaggagcagatccagtattaaaagagggaaatcttttaacaaat
gtatttaatagacttattcgctcatgtttttatacattgcaaagtcttaatgaagatatt
cctaaagaagatgtaagtgaaaagattaaggaattaacagaaaaatcagtattagaatat
gaaagacatatgtataatcaagattttcatagaatagcatatgttcttgatgattatata
agggaagtaaataaacattgggctagtaatattaaaaatgaggaattaaaaagaaacgta
atagcagattgtttttacgcttgcaaagttatagcagtactaatacaccctatagcacca
gaaggatgtgaaatgtttaaagattatctaaatatagatgatgagctatggaattgggat
aagatatttgaacctattacttcttattttgaagatgctaagagccataagtttaaattt
cttgaaccaaaagtagatttctttaagaaaatggaatatcaatattga

DBGET integrated database retrieval system