KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_3630Help
Entry
Cbei_3630         CDS       T00547                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00071  Fatty acid degradation
cbe00072  Synthesis and degradation of ketone bodies
cbe00280  Valine, leucine and isoleucine degradation
cbe00310  Lysine degradation
cbe00362  Benzoate degradation
cbe00380  Tryptophan metabolism
cbe00620  Pyruvate metabolism
cbe00630  Glyoxylate and dicarboxylate metabolism
cbe00640  Propanoate metabolism
cbe00650  Butanoate metabolism
cbe00900  Terpenoid backbone biosynthesis
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
cbe01212  Fatty acid metabolism
cbe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cbei_3630
   00630 Glyoxylate and dicarboxylate metabolism
    Cbei_3630
   00640 Propanoate metabolism
    Cbei_3630
   00650 Butanoate metabolism
    Cbei_3630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cbei_3630
   00072 Synthesis and degradation of ketone bodies
    Cbei_3630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cbei_3630
   00310 Lysine degradation
    Cbei_3630
   00380 Tryptophan metabolism
    Cbei_3630
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cbei_3630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cbei_3630
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cbei_3630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbe04147]
    Cbei_3630
Enzymes [BR:cbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Cbei_3630
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cbei_3630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABR35750
UniProt: A6LZH0
Position
complement(4178927..4180105)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTAIGAYGKTLKDVPAVELGAIVIKEAVKRANIKPEEINEVIFGNVLQAG
LGQNPARQAAVKAGLPIEIPAFTINKVCGSGLRAISLAAQIIKAGDADAIVVGGMENMSS
APFLLDNARWGQRMGHGEFIDEMIKDGLWDAFNDYHMGVTAENVAEKWNVTREEQDEFSL
LSQQKAEKAIKSGEFKDEIVPVVIKTKKGEIIFDQDEFPRFGNTIEALKKLKPIFKENGT
VTAGNASGLNDGAAALVIMSADKAKALGIKPLAKITSYGSAGLDPAIMGYGAFYATKAAL
DKINLKAEDLDLIEANEAYASQSIAIARDLNLDMNKVNVNGGAIALGHPIGASGARILVT
LLHAMEKRDAKKGLATLCIGGGQGTALIVERE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagtaatagtaagtgcagtaagaactgcaattggagcttatgggaagact
ttaaaggatgtaccagcagttgaattaggtgcaatagtaataaaagaagctgttaaaaga
gcaaatattaaaccagaggaaattaatgaagttatctttggaaatgtccttcaagcaggc
cttggacaaaacccagcaaggcaagcagctgtgaaagctggactacctatagaaatacct
gcatttacaattaataaggtttgtggctcaggattaagagctataagtttagcagcacaa
attataaaagctggtgatgctgatgctatcgtagtaggtggtatggaaaacatgtctagt
gcaccatttttacttgataatgcaagatggggacaaagaatgggacatggagaattcatt
gatgaaatgataaaagatggtttatgggatgcattcaatgattatcatatgggagtaact
gcagaaaacgtagctgagaaatggaatgtaacaagagaagaacaagacgagttttcactt
ttgtcacaacaaaaagctgaaaaagctatcaagagtggagaattcaaagatgaaatagtg
cctgtagtaatcaaaactaaaaaaggtgaaataatatttgatcaagatgaattccctagg
tttggtaatactatagaagcattaaaaaaacttaaacctatttttaaggaaaatggtaca
gttacagcaggaaatgcatctggattaaatgatggagcagcagcattagtaattatgagt
gcagataaagctaaagctctaggaataaagccacttgctaaaatcacttcttatggatca
gcaggattagacccagcaataatgggatatggtgcattttatgcaacaaaagctgcctta
gataaaatcaatttaaaagctgaggatttagatttaatcgaagcaaatgaagcctatgca
tcacaaagtatagcaatagctagagatttaaacttagatatgaataaagtaaatgttaat
gggggagccatagctcttggacatcctattggtgcatctggagcacgtattttagtaact
ttgctacatgctatggaaaaaagagatgcaaaaaaaggacttgcaacattgtgcattggt
ggaggtcaaggaactgccttaatagttgaaagagaataa

DBGET integrated database retrieval system