KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4415Help
Entry
Cbei_4415         CDS       T00547                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4415
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Cbei_4415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PKD_2
Motif
Other DBs
NCBI-ProteinID: ABR36524
UniProt: A6M1P4
Position
complement(5091231..5091833)
Genome map
AA seq 200 aa AA seqDB search
MIKNIIFDLGNVILDFQPKIYVRSKIDEEKVEEIYKCIFQSDEWPMLDRGTICEEDAKRN
IINRNTESEELINKVFENWYDMLIPIESSVDTLKKLKQKGYKIYYLSNFHLAAFEYINNK
YDLFKLFEGGVVSYKEKLLKPEKEIYEKILYRYSLEPGETLFIDDMEQNIEAAIKLGLKG
IVLKEPRKLEDELQKFDINI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatataatatttgatcttggaaatgttattttagattttcaaccgaagata
tatgtaagatcaaaaattgatgaagaaaaagtagaggaaatatataaatgtatatttcag
agtgatgaatggccaatgcttgatagaggaacaatttgtgaagaagatgctaaaagaaat
ataattaacagaaacactgaaagtgaagagttaattaataaagtctttgaaaattggtac
gatatgctgattccaatagaaagcagcgtagatacattgaaaaaactaaagcaaaaaggt
tataaaatttattatctatctaattttcatttagcagcttttgaatatataaataataag
tatgacttatttaaattatttgaaggaggagtggtttcttataaagagaaattacttaaa
cctgaaaaagaaatttatgagaagatactatatagatatagtttagaaccaggcgaaact
ctatttatagatgatatggagcaaaatatcgaagctgctattaagcttggattaaaagga
atagtcttaaaagaaccaaggaaactggaagatgaattacaaaaatttgatatcaatatt
taa

DBGET integrated database retrieval system