KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4442Help
Entry
Cbei_4442         CDS       T00547                                 

Definition
(GenBank) glycoside hydrolase, clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00052  Galactose metabolism
cbe00561  Glycerolipid metabolism
cbe00600  Sphingolipid metabolism
cbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cbei_4442
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cbei_4442
   00600 Sphingolipid metabolism
    Cbei_4442
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cbei_4442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 HERV-K_REC
Motif
Other DBs
NCBI-ProteinID: ABR36551
UniProt: A6M1S1
Position
complement(5127556..5129769)
Genome map
AA seq 737 aa AA seqDB search
MAIKFNAKSKEFHLYNKEISYIIKILDNNELGNLYYGKRIHHKESFSYLFEGGMRPLAAY
VFEGDTFFSLQHTRQEYPSYGTTDFRYPAFEIKQENGSKITNFQFQSYNIFQGKKKLEQL
PATYVENEKEAQTLEIILYDDLISTRLVLSYTIYEDFPIITRNAKFIYKGEDKVILTKAM
SCSIDLPDYDYEMVHLSGAWSRERHIRNKKLDHGVQSIYSLRGTSSAEHNPFIALKRPST
TEFEGEVYGFSLVYSGNFLGEVLVDTHDTSRIMLGIHPSMFEWILNKDESFQTPEVVMAY
SDKGINGMSQAYHKLYRTRLARGYWRDKARPILINNWEATTFDFDEEIILNIAKTASELG
IELFVLDDGWFGSRNNDKAGLGDWYVNTKKLPDGIVGLSKKIENMGMKFGLWFEPEMVNK
DSDLYRAHPDWIIHTPNRTASHCRNQYTLDFSRKEIVNYIYNAMSKVFREASISYVKWDM
NRYITECYSVSTIAENQGKVMHEYILGVYALYERLTSEFPHILFESCSSGGARFDPGILY
YAPQGWTSDNTDAVERMKIQYGTSYVYPISCMGAHVSEVPNQQVFRITPLETRANVACFG
AFGYELDLNHLSEEERTIVKKQVKFMKENRELIQKGTFYRLISPFENKLNSWMVVSEDKS
EAIVGYYKILNTANEGFKRIKLQGLDENKKYYINNNKEESFFGDELMFAGIPVRSEDFCE
HGGDFTSAIYHLNEINN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaatttaacgcaaaatcaaaggaatttcatttatacaataaagagataagt
tatatcataaaaatactagataataatgagctgggaaatttatattatgggaagaggata
catcataaagaatcattttcatatctttttgaaggggggatgcgtcctttagcagcatat
gtatttgaaggcgatactttcttttcgctgcaacatactaggcaggaatatccttcttat
gggacaacagattttcggtatcctgcatttgaaataaagcaggaaaatggaagtaaaatt
actaattttcaatttcaatcctataatatttttcaaggtaaaaagaaattagaacaactt
ccagctacctatgtggaaaatgagaaagaagcacaaactttagaaataatattatatgat
gatttgattagtacaagattagtattaagttacaccatatatgaagatttcccgataata
acaagaaatgcaaagtttatctataaaggagaagataaagttatattaacaaaggcaatg
agttgtagtatagatttaccagattatgattacgaaatggtgcacctttctggagcttgg
agtagagaaagacatataagaaataaaaaattagaccatggagtccaatcaatttacagt
ttaagagggacaagtagtgcagagcataatccatttatagccttgaagagaccaagcaca
actgagtttgagggcgaagtgtatggatttagcttagtttatagtggaaattttttgggt
gaagttcttgttgatactcatgatacatctagaattatgttaggaattcatccaagtatg
tttgaatggatactaaataaagatgaaagttttcaaactccagaagttgtaatggcctat
tctgataaaggaataaatggaatgagtcaggcttaccataaattatatagaaccagactt
gctagaggctattggagagataaggcaaggccaattctaataaataattgggaagctaca
acatttgattttgatgaagagataatattaaatattgcaaaaacagcaagtgaattaggc
atagagctatttgtgttagatgacggatggtttggaagtagaaataatgataaagcaggg
cttggagattggtatgtaaatactaaaaagcttccagatggaatagttggactttcaaag
aagatagaaaacatgggtatgaaatttggactttggtttgaaccagagatggtaaataaa
gatagtgatttatacagagctcatccagattggattatccatacaccaaataggacggca
tcccattgtagaaatcagtatacactagatttttcaagaaaggaaatagtaaattatatc
tataatgcaatgtcaaaagtattcagagaggcatcgatatcatatgtaaagtgggatatg
aatagatatataactgaatgttacagtgtctctacaattgcggaaaatcaaggaaaagta
atgcatgaatacattttaggagtgtatgcattatatgaaagattaacatctgaatttcca
cacattttatttgaatcatgttcgagtggtggtgcaagatttgaccccggaatactttat
tatgcaccacaaggatggacaagtgataataccgatgcagttgaacgtatgaaaatacaa
tatggaacttcatatgtttacccaataagctgcatgggggctcatgtatctgaagttccg
aaccaacaagtttttagaataacgccactagaaactagagcaaatgtagcttgttttgga
gcttttggatatgagctagatttaaatcatttatccgaagaagaaagaacgattgtgaag
aaacaagttaaatttatgaaagaaaatagagaattaatacaaaagggaactttttatagg
cttataagtccttttgaaaataaattaaattcttggatggttgtctcagaagataaatcc
gaagcaatagttggttattataaaatacttaacacagctaatgaaggttttaagaggata
aagttacaaggattagatgaaaataaaaaatattatataaataataataaagaagaatct
ttttttggagacgaattaatgtttgctggaattccagtaagatcagaagatttttgcgaa
catggtggagatttcacttcagcaatatatcatttgaatgaaataaataattag

DBGET integrated database retrieval system