KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4541Help
Entry
Cbei_4541         CDS       T00547                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00030  Pentose phosphate pathway
cbe00051  Fructose and mannose metabolism
cbe00680  Methane metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4541
   00030 Pentose phosphate pathway
    Cbei_4541
   00051 Fructose and mannose metabolism
    Cbei_4541
  Energy metabolism
   00680 Methane metabolism
    Cbei_4541
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Cbei_4541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ABR36650
UniProt: A6M220
Position
5256114..5258075
Genome map
AA seq 653 aa AA seqDB search
MEKYDDIKYLSLLAKQYPTIAAASTEIINLEAILNLPKGTEHFLADLHGEYEPFVHVLKN
GSGAIKRKIQEVFENSLMDCEKRSLTTLVYYPEQKLEIVLREEKDINDWYKINLYRLIEL
CRHVSSKYTRSKVRKALPPDFSYIIEELLHEESDNNDKQGYYDGIINTIIEIERAQEFIV
ALSKLIQRLVIDRLHIIGDIFDRGPRPDIILDTLINYHSVDIQWGNHDILWMGAASGNTT
CIANVLRIAARYSNLDVIEDIYGINLLPLATFALKHYKNDNCIAFVPKNTDETLYGASEI
ELISKMHKAITIIQFKLEYEIIKRRPEFNMDHRLLLDKINYSDGTITLNNITYELCDKSF
PTININNPFELTSDEKKLVSKLQISFINSDKLQKHVLFLFNKGRLYLTYNSNLLFHGCIP
LNKDKTFKSMTIHGEEYKGKKLLDKFDSLAREGYFSTRGSAEKLYGIDIMWYLWTGACSS
LFGKEDMTTFERYFIKDKSTHKEKKNPYYNFRDSEEMCNMIFEEFGLDPAESRIINGHVP
VKNKFGENPIKCNGKLIVIDGGFAKAYRSQTGLAGYTLTYNSYGLQLISHQPFKSIEDAF
SKETDILSSTQIVEKLDRKKVGDTDIGKELKNQIKDLKLLLKAYRKGLINEVR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatgatgacataaaatatttaagtctgcttgctaagcaatatcctactatt
gcagcggcatcaactgaaataattaatttagaagctattttaaatttacctaaaggtaca
gaacattttttagctgaccttcatggtgagtatgagccttttgttcatgtattaaaaaat
ggttcaggggctataaagagaaaaattcaagaggtatttgaaaattctttaatggactgt
gaaaaaagaagtttaaccacacttgtatactatcctgaacaaaaattagagattgttcta
agagaagaaaaagatataaatgattggtataaaattaatctgtataggttgattgaatta
tgcagacatgtatcttctaaatatacaagatctaaagtaagaaaagcgctacctccagat
tttagctacattatagaagaattattacatgaagaatctgataataatgataaacagggt
tattatgatgggataataaatactattatcgaaattgaacgagcccaagagttcatagtg
gctctatctaaattaatacaacgactagtaatagatagattacacataatcggagatata
tttgatagaggtcctagaccagatataatcctcgatacccttataaattatcattctgtt
gatatacaatggggtaaccatgatatattgtggatgggtgctgcctcaggtaatactaca
tgtatagcaaatgttttaagaatagcagctagatattctaatctagacgtcatcgaagat
atttacggtataaatttattacctcttgcaacttttgcacttaagcactataaaaatgat
aattgcatagctttcgttcctaaaaacacagatgaaacattatatggagcctctgaaatt
gagcttatttctaaaatgcataaagccataacaattattcaatttaaacttgaatatgaa
attataaaaagaagacctgaatttaatatggatcatagattacttttagataagataaat
tatagtgatggcaccataactttaaacaatataacttatgagctttgcgacaaaagtttc
cctacaatcaatattaataatccttttgaacttacgagtgatgaaaaaaaattggtttct
aagcttcaaatttcatttataaatagcgataaattgcaaaagcacgttctatttttattt
aataaaggaagactatatttaacttataattctaatcttttatttcacggctgtattcct
ttaaataaagataaaacttttaaaagtatgactattcatggtgaagagtataaaggaaaa
aaacttctagataaatttgattctttagctagagaaggttatttcagtactagaggcagt
gctgaaaaattatatggtattgatataatgtggtatttatggactggagcctgttcttct
ctttttggaaaagaagatatgacaacttttgaaagatactttataaaagacaaaagtaca
cataaagaaaagaaaaatccctactacaattttagggattctgaagaaatgtgtaatatg
atttttgaagaatttggattagatccagctgaatcacgaataataaatggacatgttcca
gttaaaaataaatttggagaaaacccaataaagtgtaatggaaaactgatagttatagat
ggtggctttgctaaagcttatagaagtcaaactggcctcgcaggatacacattgacttat
aattcctatggacttcagctaatatctcatcaacctttcaaatcaattgaagatgcattt
agtaaagaaacggatatattatcttcaacacaaatagtagaaaaactagacagaaaaaaa
gttggtgatacagacataggaaaggagcttaaaaatcaaattaaagatttgaaattattg
ctcaaagcctatagaaaaggattaataaacgaggtaagatag

DBGET integrated database retrieval system