KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4895Help
Entry
Cbei_4895         CDS       T00547                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00052  Galactose metabolism
cbe00500  Starch and sucrose metabolism
cbe00520  Amino sugar and nucleotide sugar metabolism
cbe00521  Streptomycin biosynthesis
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
Module
cbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4895
   00052 Galactose metabolism
    Cbei_4895
   00500 Starch and sucrose metabolism
    Cbei_4895
   00520 Amino sugar and nucleotide sugar metabolism
    Cbei_4895
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cbei_4895
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cbei_4895
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cbei_4895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABR37001
UniProt: A6M321
Position
complement(5731028..5731981)
Genome map
AA seq 317 aa AA seqDB search
MQKYVIGVDLGGTKISTALSNLNGEVLCQTTVPTNASEGEIPVLNRIIESVEKVIKDGSV
TYKDIKGIGIGSPGPLDAEKGTIIYTPNLPFKNFNLVEPLNKKFEVPVFLDNDANVAAIG
EYMFGAGKGAKDVVFFTVSTGVGGGAVLNGKVYRGHTSNALEIGHMTVAPDGPRCNCGNI
GCVEATSSGTAIAKRGQEALASKVETSLRKYDTITSYEVFTEAAAGDPVCVDIINNALNY
LGIAIANAVSIFDPEIIIIGGGVSKAGEIVFDTVRKVVDKRCFKSMAESVKIVPAGLGTD
AGVIGAVALALLETEDK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatatgttataggagtagatttaggaggaactaagataagtactgcattatct
aatttaaatggagaagtgttatgtcaaacaacagttcctacaaatgcaagcgagggagaa
attccagtattaaatagaattatagaatctgttgaaaaagtaattaaagatggatcagta
acttataaagatataaaaggaattggtatcggttcccctggacctttagatgctgaaaaa
ggaaccataatctatacaccaaaccttccatttaagaattttaatttagtggaaccttta
aataaaaagtttgaagttcctgtatttttagataatgatgcaaacgttgcagctatcggt
gaatatatgtttggtgcaggaaaaggcgctaaagatgtagtattcttcacagtaagcact
ggcgtaggcggaggcgctgtcttaaatggaaaggtatatagaggacacacttcaaatgcc
ttagaaataggacatatgacagtggcaccagatggaccaagatgtaattgtggaaatata
gggtgtgtagaagcaacatcatcaggaactgcaattgcaaaaagaggacaggaagcatta
gctagcaaagttgagacttcattaagaaagtatgatactattacttcatatgaggtgttt
acagaagcggctgcaggagatccagtttgcgtagatataattaataatgcactgaattat
ttaggaatagctatagctaatgcagtatctatatttgatccagaaattataataataggt
ggtggtgtatcaaaagctggagagattgtttttgatacagtaagaaaagttgttgataag
agatgttttaaatccatggcagaatcagttaagattgttccagcaggattaggtacagat
gcaggggtaattggtgcggtagcattagcattgcttgaaacagaagataagtaa

DBGET integrated database retrieval system