KEGG   Clostridium beijerinckii NCIMB 14988: LF65_00469Help
Entry
LF65_00469        CDS       T04773                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
cbei00071  Fatty acid degradation
cbei00072  Synthesis and degradation of ketone bodies
cbei00280  Valine, leucine and isoleucine degradation
cbei00310  Lysine degradation
cbei00362  Benzoate degradation
cbei00380  Tryptophan metabolism
cbei00620  Pyruvate metabolism
cbei00630  Glyoxylate and dicarboxylate metabolism
cbei00640  Propanoate metabolism
cbei00650  Butanoate metabolism
cbei00900  Terpenoid backbone biosynthesis
cbei01100  Metabolic pathways
cbei01110  Biosynthesis of secondary metabolites
cbei01120  Microbial metabolism in diverse environments
cbei01130  Biosynthesis of antibiotics
cbei01200  Carbon metabolism
cbei01212  Fatty acid metabolism
cbei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LF65_00469
   00630 Glyoxylate and dicarboxylate metabolism
    LF65_00469
   00640 Propanoate metabolism
    LF65_00469
   00650 Butanoate metabolism
    LF65_00469
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LF65_00469
   00072 Synthesis and degradation of ketone bodies
    LF65_00469
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LF65_00469
   00310 Lysine degradation
    LF65_00469
   00380 Tryptophan metabolism
    LF65_00469
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LF65_00469
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LF65_00469
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LF65_00469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbei04147]
    LF65_00469
Enzymes [BR:cbei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LF65_00469
Exosome [BR:cbei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LF65_00469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJG97113
UniProt: A0A0B5QK71
Position
470426..471607
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTALGSFGGALKDVSAVDLGALVIKEAVNRAGVKPELIEEVIMGNVIQAG
LGQNTARQSTIKAGLPQEVSAMTINKVCGSGLRAVSLAAQMIKAGDADVVVAGGMENMSA
APYALDKARWGQRMGDGKLVDTMIKDALWDAFNNYHMGVTAENIAKQWGLTREEQDAFSA
ASQQKAEAAIKSGRFKDEIVPVVIPQRKGEPKVFDTDEFPRFGTTAETLAKLKPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAEELGLKPMAKILSYGSKGLDPAIMGYGPFHATKKA
LEKANLTVEDLDLIEANEAFAAQSLAVAKDLKFDMSKVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDAKKGLATLCIGGGMGTALIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtagttattgtaagtgcagtaagaacagcattaggtagttttggtggagca
ttaaaagatgtctcagcagtagatttaggagctttagtaattaaagaagccgtaaataga
gctggagtaaaacctgaattaattgaagaagttattatgggtaatgtaattcaagctggt
cttggtcaaaataccgcaagacaatcaacaataaaagctggattaccacaagaagtttca
gctatgactattaataaggtttgtggatcaggtcttagagcagttagtttagcagcacaa
atgattaaagcaggagatgctgatgttgttgttgctggaggtatggaaaatatgtcagct
gccccatatgcattggacaaagcaagatggggacaaagaatgggcgatggtaaattagtt
gatacaatgataaaagacgcattatgggatgcttttaacaactaccatatgggagttaca
gctgaaaatattgctaaacaatggggattaactagagaagagcaagatgctttctcagct
gcatctcaacaaaaagctgaagcagcaattaaatctggaagatttaaagatgaaatagtt
ccagttgttattccacaaagaaagggagaaccaaaagtatttgatacagatgaattccca
agattcggaacaacagcagaaactttagctaaattaaagccagcatttattaaagatggt
actgttacagcaggtaatgcatcaggtattaatgatggagcagcagcttttgttgttatg
agtgcagaaaaagcagaagaattaggacttaagccaatggctaaaatactttcttatggt
tcaaaaggattagatccagctatcatgggatatggaccattccatgcaactaagaaagct
ttagaaaaagctaatttaacagtagaagacttagatttaatagaagctaatgaagctttc
gctgctcaaagcttagcagttgctaaagatttaaaattcgatatgtcaaaagttaatgta
aatggtggagcaattgctttaggtcatccagttggagcatcaggtgcaagaatattagta
actcttcttcatgaaatggaaaagagagatgctaaaaaaggattagctacactttgtata
ggtggcggaatgggaacagctcttatcgttgaaagaatttaa

DBGET integrated database retrieval system