KEGG   Clostridium beijerinckii NCIMB 14988: LF65_01539Help
Entry
LF65_01539        CDS       T04773                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
cbei00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LF65_01539
Enzymes [BR:cbei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LF65_01539
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LF65_01539
    1.1.1.-  
     LF65_01539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C PALP ApbA ADH_zinc_N_2 NAD_binding_7 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJG98147
UniProt: A0A0B5QJP9
Position
1731285..1732367
Genome map
AA seq 360 aa AA seqDB search
MKAALWYAKKDVRVEEIEEPKVTVNGVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHPLS
GTTAPVVLGHEFSGDVVEVGPNVKNFKPGDRVIVEPIVACGKCPACLEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFVHKIPDEMSYEQAALVEPMAVALHSIRIGNFRTGDTALVLG
SGPIGLATIECLKAAGAKLIIVLQRKSIRQEYAKRAGADVVLDPNEVNIAEEVKKLTNGL
GVDVAFETTGAQIGFDTGIDSLKFEGTLVVTSIWENDVKFNPNVLVFTEKKIIGTLAYRH
EFPATMAQMKDGRIKAEGYVTKKIHLDDIVEEGFGALTGPEKKKHVKILVSPDKELVSKS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgcaaagaaagacgttagagtagaggaaattgaagaacct
aaagttacagttaatggtgtaaagattaaagtaaaatggtgtggaatatgtggatcagat
ttacatgaatatttaggaggacctatatttataccagtaggacaacctcacccattaagt
ggtacaacagctccagtagttttaggacatgaattttcaggagatgtcgttgaagttggt
cctaatgtaaagaattttaaaccaggagatagagtaatagttgaacctatagttgcatgt
ggaaaatgtccagcatgcttagaaggaaaatataatttatgttcatcattaggtttccat
ggactttgtggaagtggtggaggacttgctgaatatacagttttcccagaagaattcgta
cataagattccagatgaaatgtcttacgaacaagctgctttagttgagccaatggcagta
gcattacattcaattagaattggtaattttagaacaggggatactgcgttagtactagga
tctggtccaataggactagcaactattgagtgcttaaaagcagctggtgcaaaattaata
atagtattacaaagaaaatctataagacaagagtatgctaaaagagcaggggcagatgta
gtattagatcctaatgaagtaaatatagcagaggaagttaagaagcttactaacggatta
ggagttgacgtggcgtttgaaactacaggagctcaaataggttttgatacaggtatagat
agcttaaagtttgaaggaactttagttgtaactagcatatgggaaaatgatgttaaattt
aatcctaatgtattagtatttactgagaagaaaatcattggaacattagcatacagacat
gaattcccagcaactatggctcaaatgaaagatggaagaataaaagcagaaggatatgta
actaagaaaatacatttagatgatatagttgaagaagggttcggagcattaacaggtcca
gaaaagaagaaacatgttaagatattagtatctccagacaaagaacttgtatctaaatct
taa

DBGET integrated database retrieval system