KEGG   Clostridium beijerinckii NCIMB 14988: LF65_02722Help
Entry
LF65_02722        CDS       T04773                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
cbei00561  Glycerolipid metabolism
cbei00640  Propanoate metabolism
cbei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LF65_02722 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LF65_02722 (gldA)
Enzymes [BR:cbei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     LF65_02722 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AJG99295
UniProt: A0A0B5QEA0
Position
complement(2988926..2990017)
Genome map
AA seq 363 aa AA seqDB search
MAKIMIAPSKYIQGNGELKNIAEYVSALGEKALCLISESGLKRVKDTIDKSFETKNIGVK
YDLFNGECSITEVNRIIKICDENQLTILIGIGGGKIIDTIKAVGYYANLPVVIVPTIAAT
DAPCSALSVLYTDDGVFDKYLFLKQNPNIVLVDTGIIAKAPVRLLVSGMGDALATYFEAR
ACEKSNAGTCAFGTTTITAQALARLCYDTLITEGYKAKLAVEEGVCTKSVEKIVEANTLL
SGLGFESGGIAAAHAIHNGLTVLPACHHMYHGEKVAFGTLAQLVLENAPMDEIEEVLDFC
TRVGLPVTLKQLGIDEIKPEEIMEVAKAATSKEDTAHNMPFEVTSEDVYAAILTANRLGQ
EYM
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattatgattgcaccaagtaaatacattcaaggtaatggagaattaaaaaat
attgcggaatacgtatctgcacttggtgaaaaagcattatgcttgattagtgaaagtggc
ttaaaaagggtaaaagatactatagacaaaagttttgagactaaaaatataggtgtaaaa
tatgatttatttaacggagaatgctctataactgaagtaaatcgtattatcaaaatttgt
gatgaaaatcaattaactattctcattggtattggcggtggaaaaattattgatactatt
aaggctgttggatactatgcaaatcttcctgttgtgattgtacctaccatagctgctaca
gatgctccatgcagtgctttgtcagttttatacactgatgatggcgtctttgataaatac
ttattcttaaagcaaaatcctaatatagttttggttgatactggtattattgcaaaagct
ccagttcgtcttttagtatctggtatgggtgatgccttagcgacatattttgaagcaaga
gcttgtgaaaaatccaatgctggaacatgtgcttttggtactactactattacagctcaa
gcattagctagactatgctatgatacattaattactgaaggatataaggcaaaacttgct
gtagaagaaggagtttgtacaaaatcagttgaaaaaatagttgaagctaatactcttctt
agtggtcttggatttgaaagcggtggtattgcagcggctcatgctatccataatggttta
actgtattgccagcttgtcatcatatgtaccatggagaaaaagttgcatttggtacatta
gctcaattagttcttgaaaatgctccaatggatgaaattgaagaagtattagatttctgt
actagagtcggtcttcctgttactttaaaacaattaggtatcgatgaaataaaaccagaa
gaaattatggaagttgcaaaggctgctacttcaaaagaagatactgcacataatatgcca
tttgaagttacctctgaagatgtctacgctgctattttaacagctaacagattaggacaa
gaatatatgtaa

DBGET integrated database retrieval system