KEGG   Clostridium beijerinckii NCIMB 14988: LF65_03668Help
Entry
LF65_03668        CDS       T04773                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
cbei00450  Selenocompound metabolism
cbei00970  Aminoacyl-tRNA biosynthesis
cbei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LF65_03668
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LF65_03668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbei01007]
    LF65_03668
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbei03016]
    LF65_03668
Enzymes [BR:cbei01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LF65_03668
Amino acid related enzymes [BR:cbei01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LF65_03668
Transfer RNA biogenesis [BR:cbei03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LF65_03668
 Prokaryotic type
   Other AARSs
    LF65_03668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 DUF2481
Motif
Other DBs
NCBI-ProteinID: AJH00225
UniProt: A0A0B5QDE2
Position
complement(4019277..4021373)
Genome map
AA seq 698 aa AA seqDB search
MFYRGFFDVKIEHIKNYKFKISYMFYFLIIPSMKVRNLRSDKFMISKRIEKNERPIFPKK
AIVTAGMPYGNKNLHFGHVGGMFIHADIFARFLRDRIGKENVIFVSGTDCYGSPILESYR
KLKENGYENTMEDYVKANHLSQKKTLEDYNISLNIFGASALGRTGEFHNEVSEEIFNTLF
KNGYIKKMSALQFYDEDKKIFLNGRQVIGKCPIAGCNSDKAYAEECSLGHQYMASELINP
ISTLSGNKPILKSVDNWYFTLDESMDIMKELNEFLKKNTNRRKYEINTIDEFLKKPLIYV
PRKYIKDVNELEAKFPSHETIDEEKKSSLAFIFQTLEDRDKAKEILDNLNINYTSGKTLV
PFRLSGNIEWGVKVPDKEDLKNLTFWVWPESLWAPISFTKAYLESRGKNPEEWRNWWDND
DSMVYQFIGEDNIYFYSIAEMAMFIGLKVPKGENVDVTKLNLPHIVSNKHILFMDKKASS
SSDIKPPMADELLKFYTKDQLRMHFMSLGLSSKSVGFKPQVYMKEEEKVGADPVLKEGNL
LTNVFNRLIRSCFYTLQSLNEDIPKEEVSKKIKELTEKAVLEYERHMYNQDFHRIAYVLD
DYIREVNKHWASNIKNEELKRNVIADCFYACKVIAVLIHPIAPEGCEMFKDYLNIDDELW
NWDKIFEPITSYFEDAKSHKFKFLEPKVDFFKKMEYQY
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
attttctacaggggcttttttgacgttaaaattgagcatataaaaaattataagtttaaa
atatcatacatgttttattttttgattatcccaagtatgaaagttagaaatttaaggagt
gataagtttatgataagtaaaagaatagaaaaaaacgaaagaccaatatttccaaagaag
gctatagtaacagctggaatgccttatggaaataagaatcttcattttggccatgttgga
ggaatgtttattcatgcagatatatttgcaagatttttaagagacagaatagggaaagaa
aatgttatttttgtatctggcacagattgttatggttcacctatccttgaaagctacaga
aagctaaaggaaaatggatacgaaaatactatggaggactacgttaaggcaaatcatttg
agccaaaagaaaaccttagaagattacaatatcagcctaaatatttttggagcttcagcc
cttggaaggacaggagaatttcataatgaagtttcagaagaaatatttaatactttattt
aaaaatggttatataaagaagatgtcagcattgcaattttatgatgaagataagaaaatc
tttcttaatggaaggcaagtgatcggaaaatgtccaatagctggatgtaactctgataaa
gcctatgcagaagaatgttcattagggcatcaatatatggcatctgaattaattaatcct
attagcactttatcaggaaataaaccaatattaaaaagtgtagataattggtattttacc
ttagatgaatccatggatataatgaaggaacttaatgagtttttaaagaagaatactaat
agacgaaagtatgaaattaacaccatagatgaatttttgaagaagccactaatatatgtc
ccaagaaaatatataaaagatgtaaatgagctagaagctaaatttccaagccatgaaact
atagatgaagagaaaaaatcttcactagcttttattttccaaacactagaggatagggat
aaggcaaaggaaatattggataatttaaatattaactatactagtggtaagactttggtt
ccttttagattatcaggaaatatagagtggggagtaaaagtaccagataaagaagatttg
aaaaatttaaccttctgggtgtggcctgaatctttatgggctccaatttcttttacaaaa
gcatatttggagtcaagaggtaagaatcctgaagaatggcgtaattggtgggataatgat
gattcaatggtatatcaatttataggggaagataatatatatttttattcaattgctgaa
atggccatgtttattgggttaaaggtgcctaagggtgaaaatgtagatgttactaagcta
aatttaccacacattgtttctaataagcacattttatttatggataaaaaagcaagcagc
agttcagatattaagccaccaatggcagatgaattattgaaattttatacgaaagatcaa
ttacgcatgcactttatgagtcttggattatcttcaaaaagcgttggctttaagccacaa
gtttacatgaaggaagaagaaaaagtaggagcagatccagtattaaaagaaggaaacctt
ttaacaaatgtatttaatagacttattcgctcatgtttttatactttgcaaagtcttaat
gaagatattcctaaagaagaggtaagcaaaaaaattaaagaattaacagaaaaagcagta
ttagaatatgaaagacatatgtataatcaagattttcatagaatagcatatgttctggac
gattatataagggaagtaaataaacattgggctagtaatattaaaaatgaggaattaaaa
agaaacgtaatagcagattgtttttatgcttgtaaagttatagcagtactaatacaccct
atagcaccagaaggatgtgaaatgtttaaagattatctaaatatagatgatgaactatgg
aattgggataaaatatttgaacctatcacttcttattttgaagatgctaagagccataag
tttaaatttcttgaaccaaaagtggatttctttaagaaaatggaatatcaatattaa

DBGET integrated database retrieval system