KEGG   Clostridium beijerinckii NCIMB 14988: LF65_04056Help
Entry
LF65_04056        CDS       T04773                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
cbei00471  D-Glutamine and D-glutamate metabolism
cbei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LF65_04056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbei01011]
    LF65_04056
Enzymes [BR:cbei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     LF65_04056
Peptidoglycan biosynthesis and degradation proteins [BR:cbei01011]
 Precursor biosynthesis
  Racemase
   LF65_04056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AJH00601
UniProt: A0A0B5QI27
Position
complement(4444293..4445096)
Genome map
AA seq 267 aa AA seqDB search
MKIGFFDSGIGGITVLYDTLKVLPNEDYIYYADTLNVPYGPKPKDEVKKYILNAVDFIVE
QGVKAVVIACNTATSVAIEALRSKYSIPIIGMEPAVKPAIEKNKDMNKRVLVTATALTLK
EEKLHNLIYKLDNEHVVDLLPLPGLVQFSERLEFDEQIVLPYLKEELFKFDLNNYEAIVL
GCTHFSYYKDMVRKLAPSNVSIIDGNIGTAKNLKRILKEMNLLNEGHGNITFYNSGIRVE
DKAELDRYNRLFERMDNINEYNISEKI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggtttttttgattcaggtattggcggtatcactgtattatatgatacgtta
aaagtgttacctaatgaagattatatatattatgcagatacattaaatgttccatatgga
ccaaaaccaaaagacgaagttaaaaagtatattttaaatgctgtagattttattgttgaa
caaggagttaaggcagtagttattgcttgtaatactgctacaagtgtagcaatagaggcg
ttgagaagtaaatatagcattccgattattggtatggagcctgcagtaaagcctgccatt
gagaaaaacaaagatatgaataaacgagtattggtaactgccactgctttgacgttaaag
gaagaaaaattacataatcttatttataaattagataacgaacatgttgttgacttactg
cctcttccaggactagttcaattctcagaaagactcgagtttgatgaacaaatagtatta
ccgtatcttaaagaggagttatttaaatttgatttaaataattatgaggctattgtttta
gggtgtacccatttttcttactataaggatatggttagaaaattagcgccttcaaatgtt
agcataattgatggaaatattggtactgcaaaaaatcttaaaagaattttgaaagaaatg
aatttattaaatgaagggcatggcaacatcactttctataattcaggaattagagtcgag
gataaagcagaattagatagatataacagactatttgaaagaatggataatatcaacgaa
tataatatttctgaaaagatttaa

DBGET integrated database retrieval system