KEGG   Colwellia beringensis: B5D82_06585Help
Entry
B5D82_06585       CDS       T05628                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
cber  Colwellia beringensis
Pathway
cber00540  Lipopolysaccharide biosynthesis
cber01100  Metabolic pathways
Module
cber_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:cber00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    B5D82_06585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cber01005]
    B5D82_06585
Enzymes [BR:cber01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     B5D82_06585
Lipopolysaccharide biosynthesis proteins [BR:cber01005]
 Unusual sugar
  B5D82_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 HAD_2 Hydrolase UPF0180 Hydrolase_6 S6PP
Motif
Other DBs
NCBI-ProteinID: ASP47452
UniProt: A0A222G6T0
Position
1569952..1570497
Genome map
AA seq 181 aa AA seqDB search
MDSLYGKVAPSVWQKAQKIKLFVCDIDGVFSDGRIYLGNNGEELKAFHTKDGYGIKALGA
SGVDVAVITGRKSNIVQTRMTALNVKHIVQGEENKLPALKAMIDALQLTPEQVAYIGDDM
PDFECLNYVGFSIAVNDAHPAILNLCDYTTYTRGGFGAVRETCDLIMQSQHTLADAKGAS
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttggatagtttatacggaaaagtagcgccaagtgtttggcaaaaagcgcaaaaaattaaa
ctttttgtttgtgacattgacggtgttttttctgatggtcgtatctacttaggcaataac
ggtgaagaactaaaagcctttcataccaaagatggttatggcattaaagctttaggggca
agtggtgttgatgttgccgtgatcacgggcagaaaatctaatatcgtccaaacacgcatg
acggcattaaacgttaaacacatagtgcaaggtgaagaaaataaactgcctgcattaaaa
gcgatgatagacgctttacaactaacgcctgaacaagttgcttacatcggcgatgatatg
ccagattttgaatgcctaaactatgttggttttagtattgcggttaatgacgcgcaccct
gccattttaaatctttgtgattacacaacctatacccgaggtggctttggtgctgtgcgc
gaaacttgcgaccttattatgcaaagtcagcatactttagccgatgcaaagggtgccagt
atatga

DBGET integrated database retrieval system