KEGG   Colwellia beringensis: B5D82_10545Help
Entry
B5D82_10545       CDS       T05628                                 

Definition
(GenBank) HAD family hydrolase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
cber  Colwellia beringensis
Pathway
cber00230  Purine metabolism
cber00240  Pyrimidine metabolism
cber00760  Nicotinate and nicotinamide metabolism
cber01100  Metabolic pathways
cber01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cber00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B5D82_10545
   00240 Pyrimidine metabolism
    B5D82_10545
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B5D82_10545
Enzymes [BR:cber01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     B5D82_10545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD NIF Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ASP48160
UniProt: A0A222G8N2
Position
complement(2466875..2467552)
Genome map
AA seq 225 aa AA seqDB search
MLDWSKISTVLLDMDGTILDLHFDNHFWLHHLPKRYSELHGVSLENAKKTLLSHYTKVAG
TIDWYCLDYWAQQTQLSITDLKREIQHLIQLRSDAHDFLVALKSSGRDIVLVTNAHPDSL
SLKIERTSLDKYFDTLYSTHEFGVTKESQILWQRLQAKHGFALESTLFVDDSLVILDSAK
KYGIAHILAVANPDSKKEDNAFNDYPSITDYGVLLAEINNSKWRS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattggtcaaaaatttcaaccgttttactggatatggatggtacgattctcgat
ttacattttgataaccatttttggctacaccatttacccaaacgttacagtgaattgcac
ggcgtaagtttagaaaatgcgaaaaaaactttattaagtcactatacaaaagtagcagga
acaatcgattggtattgtttagattattgggctcaacaaacgcaactttcaataaccgac
ttaaaacgtgaaattcagcacttaattcaattacgctctgatgcacatgactttctagtt
gcattgaaatcatctggccgtgatatcgtgcttgttaccaatgctcatcctgatagttta
tcgctaaaaatagaacgcacatcgttagataaatattttgatacgctctactcaacacac
gaatttggtgtcacaaaagagtctcaaatactctggcaacgattacaagcaaagcatggt
tttgctttagaaagcacgctttttgttgatgacagtttagtgatactagactcggctaaa
aaatacggcattgcacatatattagccgtggcaaaccctgatagtaaaaaggaagacaat
gcttttaatgactacccgtcaattaccgactacggagttttactcgcagaaataaataac
agcaagtggcgaagttaa

DBGET integrated database retrieval system