KEGG   Clostridium botulinum F Langeland: CLI_0132Help
Entry
CLI_0132          CDS       T00563                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00450  Selenocompound metabolism
cbf00970  Aminoacyl-tRNA biosynthesis
cbf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CLI_0132 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLI_0132 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbf01007]
    CLI_0132 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbf03016]
    CLI_0132 (metG)
Enzymes [BR:cbf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CLI_0132 (metG)
Amino acid related enzymes [BR:cbf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CLI_0132 (metG)
Transfer RNA biogenesis [BR:cbf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CLI_0132 (metG)
 Prokaryotic type
   Other AARSs
    CLI_0132 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: ABS39507
UniProt: A7G9I0
Position
100072..102009
Genome map
AA seq 645 aa AA seqDB search
MSKGTYYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRL
AEAKKVTPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYENGDIYK
SEYSGWYCTPCESFWTETQLEDGKCPDCGRPVEKAKEEAYFFKMSKYAPKLIEYIESHPE
FIQPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDDKHVIYVWIDALANYITALGY
STEKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMS
KSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSR
TVAMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEESMEKLRIPEALEEIWTFIGRA
NKYIDETTPWILAKDESKKGRLGTVLYNLAESLRIISVCISAFIPETSIKINEQINADVL
NWDSLSKFNGTKVGTKVKKGEAIFPRIDVEKKIEELNKLKEEQLKQNKAKNIAPIKEEIT
IDDFEKIDLRVAKVLECEPIKGAKKLLKLKVSLGGEERQVVSGIAKYYKPEDLIGKKVVL
VANLKPVKLRGELSQGMILAASTEDDSELFVASIDGDIEEGNIVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggaacttattatgtaacaacacctatatattatccgtcagcgaaacttcat
ataggaaatacctatacaacagttgccgcagacactttagctagatttaaaagacttaca
ggttatgatgtaatgtttttaacaggtacagatgaacacggacaaaagatacaaagatta
gcagaagctaaaaaagttacacctaaggcttatgtagatgaaatagtagcgggaataaaa
gaactatggaaaatgatgaatatagactatgataaatttataagaacaacagatgaatat
cacgtagaattagtgcaaaaaatatttaaaacattatatgaaaatggtgatatatacaaa
agtgagtattcaggatggtattgcacaccttgtgaatcattttggacagaaactcaatta
gaagatggaaagtgcccagattgtggaagacctgtagaaaaagcaaaggaagaagcatat
ttctttaaaatgtcaaaatatgctcctaaacttatagaatatatagaatctcacccagaa
tttatacaaccagaatcaagaaaaaatgaaatgctaaataactttttgaaacctggcctt
caagatttatgtgtatctagaacatcttttgattggggaataccagttacttttgatgac
aaacatgtaatttatgtttggatagatgcacttgctaattatataacagcattaggatat
agtacagaaaaggatgaactatataaaaaatactggccagcagatgtacacttagttggt
aaagatatattaagatttcatactatatattggccaattatgcttatggcattagatata
cctcttccaaagcaggtatttggtcatggatggttattggtagatggcggtaaaatgtca
aaatccaagggtaatgtggtagatccagtagttttagtaaatcattttggaacagatcct
gtaagatactatcttcttcgagaaataccttttggcgcagacggaatatttaataatgag
atttttataaagaaaataaattcagatttagcaaatgatttaggaaatttattatctaga
acagtagctatgatagaaaaatattttgatggagaaataccagcaggaaattgcaaagaa
gatatagatgaagagttaataaaattagcccttgaaactccaaaaaaagtggaagaaagt
atggaaaaactaagaataccagaagctttagaagaaatatggacatttataggaagagct
aataaatatatagatgaaacaacaccatggattcttgcaaaagatgagtctaaaaaaggg
agattgggtacagttttatataatctagcagaaagtttaagaataatatcagtatgtata
tcagcattcataccagaaacaagtataaaaataaatgagcaaataaatgcggatgtttta
aattgggatagtttaagtaaatttaatggaactaaagtaggcacaaaggttaaaaaagga
gaagcaatattcccaagaatagatgtagaaaagaaaatagaagagctaaataaacttaaa
gaggaacaattaaaacaaaacaaagctaaaaatatagcacctataaaagaagaaataact
atagatgattttgaaaaaatagatttaagggtagctaaggttttagaatgtgaacctata
aaaggagctaaaaaattattaaaactaaaagttagtttaggtggagaagaaagacaggta
gtatcaggaatagctaaatactataaaccagaagacttaataggtaaaaaagtagtatta
gtagctaatttaaagcctgttaagctaagaggagaattgtcacaaggaatgattttagca
gcatcaacagaagatgatagtgagctatttgtagcatctatagatggagacattgaagaa
ggaaatatagtaaggtaa

DBGET integrated database retrieval system