KEGG   Clostridium botulinum F Langeland: CLI_0275Help
Entry
CLI_0275          CDS       T00563                                 

Definition
(GenBank) malate dehydrogenase (oxaloacetate-decarboxylating)
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00620  Pyruvate metabolism
cbf01200  Carbon metabolism
cbf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLI_0275
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLI_0275
Enzymes [BR:cbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     CLI_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M AlaDh_PNT_C ELFV_dehydrog Shikimate_DH ThiF Sacchrp_dh_NADP NAD_binding_7 CCDC117 3Beta_HSD TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABS41875
UniProt: A7G9W3
Position
243643..244815
Genome map
AA seq 390 aa AA seqDB search
MDIKEKSLMVHKKFKGKLSIEGKIQVKNKEDLSIAYTPGVAEPCVKINEDKSLVYEYTMK
GNTVAVVTNGTAVLGLGDIGPYAGLPVMEGKALLFKEFADIDSFPICIDSKEPEEIIKTV
KLIAPGFGGINLEDIKAPECFYIEKKLKEELDIPVFHDDQHGTAIVVLAGIYNALRLVGK
KLEEAKIVINGAGSAGISICKLLLQAGAKNIIMCDKEGSLVKGNSNLNEAQKLIVEVTNK
ENEKGTLKDVIKGKDVFIGVSAPNILTEEMVNAMNKDSIVFAMANPTPEIMPDKAKKAGA
RVVATGRSDFPNQINNVLVFPGIFRGALDVRSKVINEEMKLAASKAIAFLVQDNELNEEY
IIPGAFDKRVAEVVAEEVKKVALKMGLSKL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaagaaaaatcactaatggtacataaaaaatttaaaggcaaattatctata
gaaggaaaaatacaagtaaaaaataaagaagatttatctatagcatatactccaggagtt
gcagaaccctgcgtaaaaataaatgaagataaatctttagtttatgaatatacaatgaag
ggaaatacagtagctgtagtaactaatggtacagcagttttaggcttaggggatatagga
ccctatgcaggattgcctgttatggaaggaaaagctcttttatttaaggaatttgcagat
atagattcatttccaatttgtatagatagtaaagaacctgaagaaattataaaaacagtt
aaacttatagctccaggatttggaggaataaatttagaggacataaaagcaccagaatgt
ttttatatagaaaaaaaattaaaagaagaattagatattccagtgtttcatgatgatcag
catggaacagctatagttgtattagcaggaatatataatgctttaagacttgtaggaaaa
aaattagaagaagcaaaaatagttataaatggtgctggctctgcaggaatatccatatgt
aaattgttattacaagcaggtgctaaaaacataataatgtgtgataaagaaggatcttta
gtaaaaggtaatagtaatttaaatgaagcacaaaaattaatagtcgaagtaacaaataag
gaaaatgaaaaaggaacattaaaagacgtaataaaaggaaaagatgtatttataggtgta
tcagccccaaatatacttacagaagaaatggtaaacgctatgaacaaagattccatagta
tttgctatggcaaatccaactccagaaataatgccggataaagcaaaaaaggcaggagct
agagtagtggctacaggaagatccgatttcccaaatcaaataaataatgtgttagtattc
ccagggatttttagaggagcattagatgtaagatctaaagttataaatgaggaaatgaaa
ctagcagcatctaaagctatagcttttttggtacaggataatgaattaaatgaagagtac
ataataccaggagcctttgataaaagagtagcagaagttgtggcagaggaagtaaaaaaa
gtagccctaaaaatgggattatcaaaattataa

DBGET integrated database retrieval system