KEGG   Clostridium botulinum F Langeland: CLI_1372
Entry
CLI_1372          CDS       T00563                                 

Definition
(GenBank) xanthine dehydrogenase family protein, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00230  Purine metabolism
cbf01100  Metabolic pathways
cbf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLI_1372
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ABS40734
UniProt: A7GCX7
Position
1433095..1433568
AA seq 157 aa
MSLKRKIKFTVNDKKYEVEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KNYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaatttacagttaatgataaaaagtatgaagtagaaata
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgagggg
gtacaaaaaaatggtgagctttcagaggttcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagtgaa
aaaaactatactgatgatgaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaagaaaatag

DBGET integrated database retrieval system