KEGG   Clostridium botulinum F Langeland: CLI_1560Help
Entry
CLI_1560          CDS       T00563                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cbf  Clostridium botulinum F Langeland
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cbf03009]
    CLI_1560
Enzymes [BR:cbf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CLI_1560
Ribosome biogenesis [BR:cbf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CLI_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ABS42085
UniProt: A7GDG4
Position
1648485..1649402
Genome map
AA seq 305 aa AA seqDB search
MEKINLQVEKEFDNVRLDLYLSKIFEDKSRSYLQGIIDEGNVLVNNKEKKRNYKLKVGDN
IEVNIPEPKLLQIEPEDIKLDIIYEDKDVIVVNKPQEMVVHPAPGVYSGTLVNALLHHCK
DLSGINGVARPGIVHRIDKDTSGILVVAKNDISHNNLAAQFKEHSISRVYMALVEGIIKY
EQGTIEAPIGRHPVDRIKMAVVKDGRHAVTHYKVIERFKNHTLVECRLETGRTHQIRVHM
SHIMHPLVGDPVYGYKKQRFNLKGQMLHAKLLGFIHPTTRQYVEFESELPEYFKKIIKIL
KNELI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataaatttacaagtagaaaaagaatttgataatgtaagattagatttatac
ttatccaaaatatttgaagacaaatctagatcttatcttcaagggattatagatgaaggt
aatgttctagtaaataataaagaaaaaaagagaaattataaattaaaagttggagataat
attgaagtaaatataccagaaccaaaattgcttcaaatagaaccagaagatattaagcta
gatataatatatgaagataaggatgtaatagttgtgaataaaccccaagaaatggtggta
catcctgcaccaggagtatattcaggaacgttagttaatgctcttttacatcattgtaaa
gatttatctggtataaatggggtagcgagacctggtattgttcatagaatagataaggat
acttcaggaatattagttgtggcaaagaatgacatatctcacaataatttagcagctcag
tttaaagagcattcaatttctagagtatatatggcattggtagagggcataataaagtat
gaacagggaaccatagaggcgcctataggtagacaccctgtagatagaataaaaatggcg
gtagtaaaagatggaaggcatgccgtaactcactacaaggtcatagagagatttaaaaat
catactttagtagagtgtaggttagaaacaggaagaacacatcaaataagagttcatatg
agccacataatgcatcctttagtaggagatcctgtttatggttataaaaaacaaagattt
aatctaaagggacaaatgttgcatgcaaagttattaggctttattcatcctactacgaga
caatatgtagaatttgaaagtgaactaccagaatatttcaagaaaataataaaaatctta
aaaaatgaattgatttag

DBGET integrated database retrieval system