KEGG   Clostridium botulinum F Langeland: CLI_1649Help
Entry
CLI_1649          CDS       T00563                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00340  Histidine metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CLI_1649 (hisD)
Enzymes [BR:cbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CLI_1649 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABS40753
UniProt: A7GDQ2
Position
1748260..1749570
Genome map
AA seq 436 aa AA seqDB search
MINVVKIGEDNKKQCMNNLKSRSKKVQKDVITSVKKILGDINENGDKALIKYTNKFDSKK
INLENIRVTSEEIKKAYELVDEKFIKAIKIAKENILFYHEKQKQRSWMVTKEDGIILGQQ
IRALETVGIYVPGGTAAYPSSVLMNTLPAKVAGVEKIVMITPPSKDGSVNPNILVAANIA
GVDEIYKAGGAQGIGALAYGTKIIPKVDKIVGPGNIYVAMAKRSVYGFVDIDMIAGPSEI
LIIADESSDPKFIAADFMSQAEHDVLASSMLVTTSERLAQKVKDQLNIQIKNLSRKEIIR
TSIKDFGAIFVVDNLEEAIELANDISPEHLEVMTEDPFTILGQIKNAGSVFLGKYAPEPL
GDYMAGPNHVLPTSGSARFFSPLSVDDYIKKSSFTYYTKRALEKVKDVTVTIAETEGLTA
HANSIRVRFDNNNFSF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgtggttaaaataggtgaagacaataaaaaacagtgcatgaataatttgaaa
agcaggtcaaaaaaagtacaaaaagatgtaattacttctgtaaaaaaaatactaggggac
ataaatgaaaatggggataaagcattaataaaatatactaataagtttgatagtaaaaaa
ataaatttagaaaatattagagttacttcagaagagataaaaaaggcttatgaattagtt
gatgaaaaatttataaaggctataaaaattgctaaagaaaatatattgttttatcatgag
aagcaaaaacaaagatcatggatggtaacaaaggaagatggaataattttaggtcagcaa
attagagctctagagactgtaggtatatacgttccaggaggaacagcagcttatccttct
tcagtattaatgaacacccttccagctaaagtagcaggagtagaaaaaatagttatgata
actcctccttctaaggatgggagtgtaaatcctaatattttagtagctgctaatattgct
ggagttgatgaaatatataaagcaggaggagcacaaggaataggagctttagcttatgga
acaaaaatcataccaaaggtagataaaatagtaggtccaggtaatatatatgtggctatg
gccaaaagaagtgtttatggctttgtggatatagatatgatagcaggacctagtgaaatt
ttgattatagcagatgaaagttctgatcctaaatttatagcagcagattttatgtctcaa
gctgagcatgatgtattggcatcctcaatgttagttactacctctgagagattagcacaa
aaggtaaaagaccaattaaatatacagataaaaaatctttcaaggaaagaaataatacgt
acatctattaaagattttggtgctatttttgtagtagataatttagaagaagctatagaa
cttgctaatgatatatccccagaacatttagaggttatgacagaagaccccttcactatt
ttaggacaaattaaaaatgcaggttctgtattcttaggtaaatatgctccagaaccatta
ggggattatatggcaggaccaaatcatgtattgcctactagcggaagtgcaagatttttt
tcacctctttcagtagatgattatattaagaaatcaagtttcacatattacaccaaaagg
gcattggaaaaagtaaaggatgttactgtaaccattgctgaaacagagggattaactgcc
catgcaaattccataagagtgagatttgataacaataatttttcattttag

DBGET integrated database retrieval system