KEGG   Clostridium botulinum F Langeland: CLI_2597Help
Entry
CLI_2597          CDS       T00563                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
cbf  Clostridium botulinum F Langeland
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cbf03036]
    CLI_2597 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cbf04812]
    CLI_2597 (ftsZ)
   02048 Prokaryotic defense system [BR:cbf02048]
    CLI_2597 (ftsZ)
Chromosome and associated proteins [BR:cbf03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    CLI_2597 (ftsZ)
Cytoskeleton proteins [BR:cbf04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   CLI_2597 (ftsZ)
Prokaryotic defense system [BR:cbf02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CLI_2597 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABS39947
UniProt: A7GGC2
Position
complement(2720890..2721999)
Genome map
AA seq 369 aa AA seqDB search
MLDFDVDVQQFAQIKVIGCGGGGNNAVNRMIIDGLKNVEFIAINTDKQALMLSQASQKIQ
IGDKLTKGLGAGANPEIGKKAAEESKEEISQAIKGADMVFITAGMGGGTGTGAAPVIAEI
AKSMGILTVGVVTKPFPFEGRKRLLHAEMGINTLKERVDTLVTIPNERLLSIVDKKTSLM
DSFKLADDVLRQGVQGISDLITIPGLVNLDFADVRTIMVDKGLAHMGVGKGTGDNRSQEA
AKQAISSPLLETSIVGATGVLLNITGGNDLGLLEINEAAEIVQEAADPDANIIFGAVIDE
NLKDELRITVIATGFESDRLEKDNIEKEENNIPKEASKSEDREEQSSTYEQHIDENDLEI
PAFLRRQRK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgctagatttcgatgttgatgtacagcaatttgctcaaataaaggttattggatgtggt
ggcggaggaaataatgctgtaaatagaatgataatagatggattaaaaaatgtagagttt
atagctataaatacagataaacaagctctaatgctttcacaggcgtctcagaagatacaa
ataggtgataaattaacaaagggattaggagcaggggctaatccagaaataggtaagaaa
gctgcagaagaaagtaaggaagagatttctcaagcaataaagggagccgatatggtgttt
ataacagcaggtatgggcggaggaactggtactggtgcagctccagtaattgcagaaata
gctaaatctatgggaatacttactgtaggtgtggtaactaaacctttcccatttgaagga
agaaaaagattgcttcatgcagaaatgggaataaatactttaaaagagagagtagacact
ttagttacaatcccaaatgaaagattattaagtatagtagataaaaaaacaagcttaatg
gactcttttaaactagcagatgatgttctaagacaaggtgtacaaggtatatcagatttg
attactataccaggacttgttaatttagattttgcagatgttagaactataatggtagat
aaaggattggctcatatgggtgtaggtaaaggaacaggagacaatagatcacaggaagca
gctaaacaagctatatcaagtcctttattagaaacatctattgttggagctacaggagta
cttcttaatataactggaggaaatgatctaggtttattagaaataaatgaggcagcagaa
attgtacaagaagctgcagatccagatgctaatatcatatttggagcagtcatagatgaa
aacttgaaagatgagttaagaataactgtaattgctacaggttttgaaagtgacagatta
gaaaaggataatattgaaaaggaagaaaacaatataccaaaggaagctagtaaaagcgag
gacagagaagagcaatcatctacatatgagcagcatatagatgaaaatgatttagagata
cctgcattcttaagaagacaaagaaagtaa

DBGET integrated database retrieval system