KEGG   Clostridium botulinum F Langeland: CLI_3196Help
Entry
CLI_3196          CDS       T00563                                 

Gene name
thrS
Definition
(GenBank) threonine--tRNA ligase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00970  Aminoacyl-tRNA biosynthesis
Module
cbf_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLI_3196 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbf01007]
    CLI_3196 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbf03016]
    CLI_3196 (thrS)
Enzymes [BR:cbf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     CLI_3196 (thrS)
Amino acid related enzymes [BR:cbf01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   CLI_3196 (thrS)
Transfer RNA biogenesis [BR:cbf03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CLI_3196 (thrS)
 Prokaryotic Type
    CLI_3196 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS DUF3804
Motif
Other DBs
NCBI-ProteinID: ABS39452
UniProt: A7GI05
Position
complement(3380307..3382214)
Genome map
AA seq 635 aa AA seqDB search
MIKITLKDGKVMEIEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEIL
TFEDEMGKWALRHTGAHILAQAVKRLYPEVKLAIGPAIDTGFYYDFEADFTFTPEMLEKI
EAEIKKIIKENHKLERFELPREEAINLMKEKNEDYKVELIEDLPEGEVISFYKQGDFTDL
CAGPHVPSTGKVKSVKLLSLAGAYWRGDEKNKMLQRIYGTAFTKKSELDEYLNMIEEAKK
RDHRKLGKELDLFSIHEEGPGFPFFHPKGMIVRNILESFWREKHTKAGYQEIRTPLILNE
ALWHQSGHWDHYKENMYFTNIDDGDYAIKPMNCPGGILVYKSSMHSYRDLPLRLSELGIV
HRHELSGALHGLMRVRCFTQDDAHLYMTKEQIKEEVIGIIKLIDEFYKLFGFEYFVELST
RPEDSMGSDEDWEIATNGLREALDSIGKEYRVNEGDGAFYGPKIDFHLKDCIGRTWQCGT
IQLDFQMPERFDLSYIGADGEKHRPVMVHRTIYGSVERFIGILIEQYAGAFPTWLAPVQV
KLMNITDSQYDYLKKVEETLKENNIRVEIDTRNEKIGYKIREAQLQKVPYMLILGDKEVE
AGKVAVRSRKDGDLGAISLEEFIEKIKNEIKNKTN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatcacattaaaagatggcaaagtaatggaaattgaagaaggaataaaaata
tctgatattgctatgaaaattagtccagctctttataaaaaagctttagcagctaaaata
gatggagaaactgtggacttaatgactgaattacacaaagatagtagtctagaaatttta
acatttgaagatgaaatgggtaaatgggctttaagacatactggtgcacatatattagca
caagcagttaaaagattatacccagaagtaaaattagctataggacctgctatagacact
ggtttttattatgattttgaagcagattttacttttacaccagaaatgttagaaaaaata
gaagcagaaattaaaaaaataataaaggaaaatcataagttagaaagatttgaattacca
agagaagaagcaataaatcttatgaaagaaaagaatgaggattataaggttgagcttata
gaagatttaccagaaggagaagttatatctttttataaacaaggagactttacagattta
tgtgcaggacctcatgtaccatctacaggaaaggttaaatcagtaaaattgttatctcta
gctggagcttattggagaggcgatgaaaaaaataaaatgcttcaaaggatatatggtaca
gcctttactaaaaaaagtgagctagacgaatatttaaatatgattgaagaagctaaaaaa
agagatcatagaaaattaggtaaagaattagatttatttagcatacatgaagagggacca
ggatttccattctttcatccaaagggaatgattgtaagaaacattcttgaaagtttttgg
agagaaaagcatacaaaagcaggatatcaagaaataaggacaccattaatattaaatgaa
gctttatggcatcaatcaggtcactgggatcactacaaagagaatatgtattttactaat
atagatgatggtgattatgcaataaaacctatgaattgtccaggaggaatactagtttat
aaaagttctatgcattcttatagagatcttccattaagactttcagaattaggaatagtt
catagacatgaattatcaggagcattacatggacttatgagagtaagatgttttactcaa
gatgatgcccatttatatatgacaaaagaacagataaaagaagaagtaataggaataatt
aaattaatagatgaattctataaactatttggatttgaatattttgtagagctttcaaca
agaccagaagattctatgggaagtgatgaagattgggaaatagcaactaatggtttaaga
gaagctttagattctataggaaaagaatatagagtaaatgaaggtgacggagctttctat
ggtccaaagatagatttccatttaaaggattgtataggcagaacatggcaatgcggaact
attcaacttgacttccaaatgccagaaagattcgatttatcatatataggtgcagatggt
gaaaagcatagacctgttatggttcatagaactatatatggaagtgttgaaagatttata
ggtatattaatagaacaatatgcaggtgcattcccaacatggcttgctccagtacaagtt
aaattaatgaatataactgattctcaatatgattatttaaagaaagttgaagaaactctt
aaagaaaataatataagggtagaaattgatacaagaaatgaaaaaatagggtataagata
agagaagctcagcttcaaaaagtgccatatatgctaatacttggagataaagaagtggaa
gcaggaaaagttgctgtaagaagtagaaaagatggagatttaggggctatatccttagaa
gaatttatagaaaaaataaagaatgaaattaagaacaaaactaactaa

DBGET integrated database retrieval system