KEGG   Coxiella burnetii CbuG_Q212: CbuG_0616Help
Entry
CbuG_0616         CDS       T00787                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00020  Citrate cycle (TCA cycle)
cbg00640  Propanoate metabolism
cbg00660  C5-Branched dibasic acid metabolism
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
Module
cbg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuG_0616 (sucC)
   00640 Propanoate metabolism
    CbuG_0616 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CbuG_0616 (sucC)
Enzymes [BR:cbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CbuG_0616 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACJ18025
UniProt: B6IZ97
Position
580065..581237
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQSKHLLKKYNIPVPASEVVFNPDAAVDAAAKIGGDRWVVKAQVHAGGRGKAGGV
RLVKNKEELKSAVKALLGMRLVTYQTDERGQPVNQILVEQTSDIARELYLGAVIDRASQR
IVFMASTEGGVEIEKVAEKSPEKILKVTVDPAIGLQPFQCRQLFFGLGLQDLKQMRSFTD
IVMGLYRLFTERDLSLLEINPLVITGSGELICLDAKINIDDSALYRQSELREMRDTTQED
EHETMAQQWELNYIKLDGNIGCMVNGAGLAMATMDLIKLSGGDPANFLDVGGSATKERVT
EAFKIIVSDKNVKGILVNIFGGIVRCDLIADGIISAVKEVGIDVPVVVRLEGNNAQLGAK
KLADSGMNIIAAKGFADAAEQIVKQVGVIA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaatcaaaacatttattaaaaaaatacaacatccccgttcct
gccagcgaagtggttttcaatcccgacgccgctgtcgatgcggccgctaaaatcggtggc
gatcgttgggttgtcaaagcccaagtgcatgccggaggtcgtggtaaagcgggtggtgtg
cgtttagtgaagaataaagaagaattaaaatcggccgtcaaggcattattaggcatgcgg
ttagtcacctatcaaaccgatgaacgtggccagccggtgaatcagatcctcgttgaacaa
acttctgatatagcacgggaattgtacctaggggcggtgattgatcgtgcttctcaacgt
atcgttttcatggcgtcgactgaaggcggtgtggaaattgaaaaagtcgctgaaaaatcg
cctgaaaaaatactaaaagttactgttgacccggccattggtttacaaccctttcaatgt
cgccaattattttttggtttagggctccaagacttaaaacaaatgcgctcattcaccgat
attgtgatgggcttataccgattatttaccgagcgcgatttaagcttattagaaattaat
ccattggtcatcactggttcgggtgaactcatttgtttggatgccaaaatcaatatcgat
gacagcgcgctttatcgtcaatccgaattgcgcgaaatgcgagacaccactcaagaagat
gagcatgaaacgatggcccaacaatgggaattaaattacatcaaactggatggaaatatc
ggttgtatggtaaacggtgctggacttgccatggcaacgatggatttaatcaaactgtcc
ggtggcgatcctgctaatttcctcgacgttggcggcagcgctactaaagaacgcgtgaca
gaagcgtttaagattattgtatcggataaaaatgttaaaggcattttagttaatattttc
ggtggtattgttcgttgcgatctcatcgctgacggaattatcagtgcagtaaaagaagtt
ggcattgatgtgccagtggttgttcggcttgaaggaaataatgctcagttgggtgcaaaa
aaattggcagatagtggcatgaatattatcgccgccaaaggatttgccgatgcagcggaa
caaattgtcaaacaagtaggggtgatcgcataa

DBGET integrated database retrieval system