KEGG   Coxiella burnetii CbuG_Q212: CbuG_1422Help
Entry
CbuG_1422         CDS       T00787                                 

Gene name
yfcX
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00071  Fatty acid degradation
cbg00280  Valine, leucine and isoleucine degradation
cbg00281  Geraniol degradation
cbg00310  Lysine degradation
cbg00362  Benzoate degradation
cbg00380  Tryptophan metabolism
cbg00410  beta-Alanine metabolism
cbg00640  Propanoate metabolism
cbg00650  Butanoate metabolism
cbg00903  Limonene and pinene degradation
cbg00930  Caprolactam degradation
cbg01040  Biosynthesis of unsaturated fatty acids
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
cbg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CbuG_1422 (yfcX)
   00650 Butanoate metabolism
    CbuG_1422 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    CbuG_1422 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    CbuG_1422 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CbuG_1422 (yfcX)
   00310 Lysine degradation
    CbuG_1422 (yfcX)
   00380 Tryptophan metabolism
    CbuG_1422 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CbuG_1422 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CbuG_1422 (yfcX)
   00281 Geraniol degradation
    CbuG_1422 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CbuG_1422 (yfcX)
   00930 Caprolactam degradation
    CbuG_1422 (yfcX)
Enzymes [BR:cbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CbuG_1422 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CbuG_1422 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CbuG_1422 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 NAD_Gly3P_dh_N AlaDh_PNT_C ApbA Methyltransf_12 Pyr_redox_2 DLH
Motif
Other DBs
NCBI-ProteinID: ACJ18724
Position
complement(1380684..1382612)
Genome map
AA seq 642 aa AA seqDB search
MNREVFTEFNKVLDEIAAQNPIAVILQSGKKKGFIAGADIKQFTDLKNKNEAFDLIRQAQ
LVLDKLEALPMPTVAMISGFCLGGGLEVALACRYRVAEDNESTLIGLPEVKLGIHPGWGG
TVRLPKLIGAPKAMEIMLPGAAVPARKAAKLGMVDAAVPLRNLENAARYFALQKPPVHKP
KGWEKYTNVSYIRPWLGRLFYKKLSAKVEKTHYPAPYAIVHNWIKEGVGKEAYFTEAQSI
AQLMMTESSRNMVRLFFLRERLKSLAKKTRYLPQQIHVIGAGVMGGDIAAWCALRGIRVT
LHDKSAEKIAPAIKRAHALYEKKLKIPRLIQAAMDRLEPDVEGTGVKKADLIIEAVFEDI
KVKQEVLSAIEPQLKPEAILATNTSSLSLDELSSVLKNPERLVAIHFFNPVAKLPLVEVA
SSQQTSADIAEKALAFVGAIDKLPLAVSSSPGFLVNRALMAYLLEANRCLDEGFSMEQID
KAATDFGMPIGPIELADRIGLDICLSVAQHLKNFYKHAEVSERLKTLVKEGHLGAKTGQG
FYHYQNGRRVESKSTAESTNPDLTDRLILQLVNEVKKCLDEKVIDKEDLADAGIVFGTGF
APFRGGPMQYAKSRGEADVVKTLKRLAKQYGERFLPSEGWSA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgggaagtttttactgaatttaataaagtgctcgatgaaattgctgctcaaaat
cccatagccgttatccttcaatcaggaaagaaaaaaggattcatcgccggtgcagacatc
aaacaatttaccgatttaaaaaacaaaaatgaagcctttgatttaatccgccaagcgcag
ctcgtccttgataagctcgaagcgctgcccatgccaaccgtagcgatgattagcggattt
tgtttaggcggcggtttggaagtggcgcttgcctgtcgctatcgagtggcggaagataat
gaatccacgctgattggattacccgaagtgaaattgggtattcatccagggtggggtggt
accgttcgattgcctaaattaatcggcgcgccgaaagcaatggaaattatgctgccaggt
gcagcagttccggcgagaaaagctgctaagcttgggatggttgacgccgcagtaccgctt
cgtaatttagaaaatgccgctcgttatttcgctttgcaaaagccccccgtccataaaccg
aaaggatgggaaaaatacacgaatgtaagttatattcgcccgtggttagggcggttattt
tataaaaaactctctgcaaaagtggaaaaaacgcattacccggcgccatacgccatcgtc
cataattggatcaaagagggggttggcaaagaagcctacttcacagaagctcagtcgatc
gcgcaattaatgatgaccgagagcagtcgcaacatggtgcgactgttttttttaagagaa
cgcttgaagtcgctcgctaaaaaaacgcgctatctgccgcaacaaattcacgttattggc
gctggtgtgatgggcggcgatattgcagcttggtgtgcgcttcgcggcatccgcgtgact
ttacacgataaatcagcggaaaaaattgcgccagcgataaagcgggcgcatgctctttat
gaaaaaaaattaaaaatcccgcgcttaattcaggcagcgatggaccgattagagccggat
gtggaaggaacgggcgttaaaaaagcggatttaattattgaagctgtttttgaggatata
aaagtaaagcaggaagttttaagtgctatcgaaccgcaattaaaacccgaggctatttta
gcgactaacacgtccagtctttctttagatgaattaagttcggtgttaaaaaaccctgag
cgcttagtggctattcattttttcaatcccgttgctaaattaccgttggttgaagtggca
agcagtcagcagacatcggcggacattgctgaaaaagcgttagcgttcgtgggagctatt
gataaattgccgttggcggtgagcagcagtccaggatttttagtcaatcgggcattaatg
gcttatttattagaagcgaaccgttgtttagacgaagggttttccatggaacaaattgat
aaagcggcaactgattttgggatgcccataggtccgatcgagctagctgatcggattggg
ttagacatatgtttgtctgttgctcaacatctgaaaaacttttacaagcatgccgaagtt
tcagaacgattaaaaacattggttaaggaaggtcatctaggcgctaaaacgggtcaaggg
ttttatcattatcaaaacggaagacgtgttgaatcaaagtctacagccgaatcaacgaat
cctgatttaaccgaccggttaatattgcaactcgttaatgaagtcaagaaatgtttggat
gagaaagtgattgacaaggaagatttagccgatgcagggatcgtatttggcacggggttt
gcaccgtttcggggtggaccgatgcagtatgccaagagtcgtggagaggccgatgtcgtg
aaaactttaaaacgcttagcaaaacaatacggtgaacgatttttgcctagcgaaggatgg
tccgcatga

DBGET integrated database retrieval system