KEGG   Coxiella burnetii CbuG_Q212: CbuG_1424Help
Entry
CbuG_1424         CDS       T00787                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00071  Fatty acid degradation
cbg00072  Synthesis and degradation of ketone bodies
cbg00280  Valine, leucine and isoleucine degradation
cbg00310  Lysine degradation
cbg00362  Benzoate degradation
cbg00380  Tryptophan metabolism
cbg00620  Pyruvate metabolism
cbg00630  Glyoxylate and dicarboxylate metabolism
cbg00640  Propanoate metabolism
cbg00650  Butanoate metabolism
cbg00900  Terpenoid backbone biosynthesis
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
cbg01212  Fatty acid metabolism
cbg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CbuG_1424
   00630 Glyoxylate and dicarboxylate metabolism
    CbuG_1424
   00640 Propanoate metabolism
    CbuG_1424
   00650 Butanoate metabolism
    CbuG_1424
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CbuG_1424
   00072 Synthesis and degradation of ketone bodies
    CbuG_1424
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CbuG_1424
   00310 Lysine degradation
    CbuG_1424
   00380 Tryptophan metabolism
    CbuG_1424
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CbuG_1424
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CbuG_1424
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CbuG_1424
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbg04147]
    CbuG_1424
Enzymes [BR:cbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CbuG_1424
Exosome [BR:cbg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CbuG_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACJ18726
Position
complement(1382786..1384081)
Genome map
AA seq 431 aa AA seqDB search
MAKPIYIVDGARTPFIKARGKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPS
ENEANIGRLIALRLGCGKDMPGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMS
RAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKPIIALLRGLTDPVCELIMGQT
AEVLAHQFNIIREAMDAYALRSHQRLAVAQENGYLKEIVPLFTDEGKFYDRDDGVRPDTS
LKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAAL
APEVMGLGPVFAATPLLQRNRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLE
KAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEILKRKKAKRGIAALCIGGGQGGA
MLLEREAGGKD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccaatctacatcgtcgacggagcgcgtacgccttttatcaaagcgcgcgga
aagcccggtcctttttcagcgtctgatttagccgtcgctgcggggcgcgcgttattaaat
cgccagccgtttgatcggactgattttgacgaagtcattatgggctgcatcatgccgagc
gaaaacgaggccaatatcgggcggttaattgcattgcgtttaggctgtggaaaagatatg
cccggctggaccgtgcaacgcaattgcggttcaggaatgcaggctattgattcagcgatg
aaagacatcgctttaggtcgtgcggatcttgtcttagccggtggcacagaagcaatgagc
cgtgcacccttaattttaaatgaaaaaatggtgaattggttagcggactggcaacaagcc
aaaagttttcgtgacaaattcactgtcatgagtcgtttacgcccccattatttcaaaccg
attatcgccttattgcggggtcttacggatcctgtgtgtgaattaattatgggacaaacg
gctgaggtgcttgcgcatcaattcaatattatccgtgaagccatggacgcctatgcttta
cgcagccaccaacgtttggccgtcgcgcaagaaaatggttacctgaaagaaattgttcct
ctttttactgacgagggaaaattttatgatcgggacgatggtgttcgcccagacacctct
ctcaaaaaattagcgcagttaaaacctatttttgatcgcaaatttggagaagtaaccgcg
gggaacagttctcaagtcaccgatggggcaagcttggtcattgtcgctagcgagaaagcc
gtaaaaaaatatcgactgccggtgctaggtcgaatcgttgacgttgaatgggccgcttta
gcgccagaggtgatgggtctcggtccggtttttgcggcgactcccctgttacaacgcaat
cggttaacgcttgaagatatcgattattgggagatgaatgaagcttttgcggccacgatt
ttagcttgtcaaaaagcgtgggctagcgaggaattttgtaaaaaatatttaggactggaa
aaagccgttggccaattagatgaagaaaaattaaatatcgatggcggcgccattgccatt
ggccatccggtgggaacgagcggcgcgcgaatcgtccttcatttattggaaattctaaaa
cgcaaaaaagcaaagcgcggcatcgctgcgctttgcatcggcggtggccaaggcggggcg
atgttgttggagagagaagcaggtggtaaagactaa

DBGET integrated database retrieval system