KEGG   Coxiella burnetii CbuG_Q212: CbuG_1550Help
Entry
CbuG_1550         CDS       T00787                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00010  Glycolysis / Gluconeogenesis
cbg00020  Citrate cycle (TCA cycle)
cbg00620  Pyruvate metabolism
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
Module
cbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuG_1550 (aceF)
   00020 Citrate cycle (TCA cycle)
    CbuG_1550 (aceF)
   00620 Pyruvate metabolism
    CbuG_1550 (aceF)
Enzymes [BR:cbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CbuG_1550 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H RnfC_N HlyD_D23 RR_TM4-6 PASTA Vfa1
Motif
Other DBs
NCBI-ProteinID: ACJ18844
Position
complement(1513431..1514741)
Genome map
AA seq 436 aa AA seqDB search
MANRIEQITVPDLGGASEVDVIEVLVKPGDTVAKEDGLITLEGDKASMDVPSPLAGTIKE
LQVKVGDKVKEGDKILTLEMSAEEEKPAKEEKKESEKSEKLEEEGKKEKEEKSEPKEEKK
KATEIKEYEAEEVEGFGTSVHAGPAVRRIAREFGIDLTKIKGTGQKDRILKEDVQKFVKE
QLKVAEGKSGIGFPPAPKIDFKKFGAIEEKPLSKIKKATGVNLSRNWMTIPHVTQFGEAD
ITELQAFRQSQKEYAAKQNVRLTPLVFIIKAVVNALKEFPHFNASLDPTGEHLILKKYFH
IGVAVDTPEGLVVPVIRDADKKGLFELAKELGEVSEKARKKGLSMNDMQGGCFSISSLGG
IGGTAFTPIINAPEVVILGVSKMQWKPICNEAGDCKTRLMLPLSLSYDHRVIDGADGARF
IVYLAERLSDIRTLLL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatcgcattgaacaaataaccgtacccgatcttggtggcgcatccgaagtggat
gtcatcgaagttttagtaaagccgggtgacaccgttgccaaagaagacggactgatcact
ttagaaggcgacaaagcctcaatggatgtgccttcgccgttggcgggtaccatcaaagag
cttcaggtaaaagtcggcgacaaagtcaaagaaggcgataaaattttaacgcttgaaatg
agcgcggaagaagaaaagcctgcaaaagaagaaaaaaaagaatctgaaaaatcggaaaaa
cttgaagaagagggaaaaaaagaaaaagaagaaaaaagtgagccaaaagaagaaaagaaa
aaggccactgaaataaaagaatacgaagccgaggaagttgagggttttggaacaagcgtt
cacgcgggccctgccgtgcgacgtattgcgcgtgaattcggtatcgatttaacaaaaatc
aaaggaactggtcaaaaagaccgaattttaaaagaagatgtgcagaagtttgtaaaagaa
cagttaaaagtagctgaaggaaaaagtggtatcggttttccgccagcgcctaaaattgat
tttaaaaaatttggcgccatcgaagaaaaacccctttcaaaaattaaaaaagcaactggc
gtaaatttaagccgtaattggatgactatcccgcatgttacccaatttggcgaagccgat
atcacagaacttcaggcattccgtcaaagtcaaaaagaatacgctgccaaacaaaacgtg
cgattaactcctttagtttttatcattaaggctgtcgttaatgcacttaaagaattcccc
cattttaatgcttcattggaccccacgggcgagcatttaattttaaaaaaatattttcat
atcggcgtagcggttgacacaccagaaggtttggtagtccctgttattcgcgatgcggac
aaaaaaggattatttgagttggctaaagaattgggtgaggttagtgaaaaagcgcgaaaa
aaagggttaagtatgaatgacatgcaaggcggctgttttagcatatcaagcttaggcgga
attggaggtacagcgtttacgccgatcattaatgcgccggaagtggtgattttgggtgtt
tctaaaatgcagtggaagccgatttgtaatgaagccggtgattgtaaaacgcgactgatg
ttacccttgagtctttcctacgatcaccgagtgatcgatggcgccgatggcgcgcggttt
atcgtttatttagccgaacggttatcggatatcagaaccttattactgtaa

DBGET integrated database retrieval system