KEGG   Coxiella burnetii CbuG_Q212: CbuG_1693Help
Entry
CbuG_1693         CDS       T00787                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase (NADP+)
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00670  One carbon pool by folate
cbg01100  Metabolic pathways
cbg01120  Microbial metabolism in diverse environments
cbg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CbuG_1693 (folD)
Enzymes [BR:cbg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     CbuG_1693 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     CbuG_1693 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH adh_short
Motif
Other DBs
NCBI-ProteinID: ACJ18970
UniProt: B6J1Z2
Position
1643803..1644654
Genome map
AA seq 283 aa AA seqDB search
MIARILDGRTCAEKVKARVKENIRLLQEKGLPSPGLAVILVGNDPASATYVAHKERACQA
VGIRSTVYRMPNTITESELASKIDECNRDSNTHGILLQLPLPAHIDSANLLERIRPDKDV
DGFHPYNLGRLVQRRPALRPCTPYGVMTLLTETHENLEGKHAVIVGASNIVGRPMALELL
LAKCTVTVCHRFTRDLAEHVKSAELLIVAIGKPGIIQSEWIKPGAIVIDVGFSRLSPNKI
AGDIDFETAKERASWITPVPGGVGPMTVATLLENTLQAAQTFL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatagctcgaattttagatgggcgtacttgcgcagagaaagtaaaagcgcgcgttaaa
gaaaacattcgtttgctccaggaaaaggggttaccttctccggggttggctgtcattttg
gttggtaacgatcctgcctcagccacttacgttgcccacaaagaacgtgcgtgtcaggca
gtgggcattcgatccactgtttaccggatgccgaatacgattacagaatcagaattagcg
tcaaaaatcgatgaatgcaaccgcgattcgaatactcacggcatcctgctacagttaccg
ttacccgcccatattgattctgctaatttgcttgaacgcattcgaccagataaagacgtt
gacggtttccacccttataatctcggccgcctagttcaacgccgccccgccttgcgtcct
tgtactccttatggcgtgatgacgcttttaacagaaactcatgaaaaccttgagggaaag
catgctgtcatcgtaggcgcttcaaatatcgttgggcgaccgatggctttggaattgtta
ctcgccaaatgtacggtaacggtttgtcatcgtttcacgcgggatttagcggagcatgtc
aaaagcgctgagcttttaattgtcgctattggcaaaccgggcattattcaaagcgaatgg
attaaaccaggcgccatcgtcattgatgtgggctttagtcgattgagcccaaataaaata
gcaggcgatattgattttgaaacggcaaaagaaagagcatcctggattacccccgtcccc
gggggagtcggacccatgaccgtagccaccttattagagaacacgcttcaagccgcacaa
acttttttataa

DBGET integrated database retrieval system