KEGG   Coxiella burnetii CbuG_Q212: CbuG_1762Help
Entry
CbuG_1762         CDS       T00787                                 

Gene name
rplV
Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CbuG_1762 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbg03011]
    CbuG_1762 (rplV)
Ribosome [BR:cbg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CbuG_1762 (rplV)
  Bacteria
    CbuG_1762 (rplV)
  Archaea
    CbuG_1762 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACJ19036
UniProt: B6J258
Position
complement(1694166..1694513)
Genome map
AA seq 115 aa AA seqDB search
MEVAAKLKYARISAQKARLVADQVRGLGAEQAVNLLRFSNKKAAALMKKVLDSAIANAEH
NEGADIDELKVSTVMVDEGPSARRFHARARGRANQILKRTCHITVKVSDSQVEND
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggcagcaaagttaaaatacgcgcgaatatcagcgcaaaaagcaagattggta
gccgaccaagttcgaggactgggagcggaacaggctgttaatttgctgcgctttagtaat
aaaaaagcggccgctttgatgaaaaaagtgttggattcggccatcgcaaatgcagagcat
aacgagggcgctgacattgatgaattaaaagtatcgaccgtaatggtggatgaggggccc
tcagcgcgacgatttcatgcgcgagctcgaggtcgtgcaaaccaaattttgaaacgcacc
tgccacatcacggtgaaggtgtcggattcgcaagtggagaacgactaa

DBGET integrated database retrieval system