KEGG   Coxiella burnetii CbuG_Q212: CbuG_2097Help
Entry
CbuG_2097         CDS       T00787                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00240  Pyrimidine metabolism
cbg00250  Alanine, aspartate and glutamate metabolism
cbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CbuG_2097 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CbuG_2097 (pyrB)
Enzymes [BR:cbg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CbuG_2097 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACJ19330
UniProt: B6J3V8
Position
2007856..2008788
Genome map
AA seq 310 aa AA seqDB search
MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTR
NSFEIAAKRLGAMVLNPNLKISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAK
QLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCVTIIGDIRHSRVANSLMDGLV
TMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF
RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLE
LFLLRDFRFF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacttcctttacatttattgaatatgcgctcactcacgcgcgaccatattgaa
aaactcatccaacgggcgaattattttttaactcagggcatggaaaaaaattcggtcttt
gaaacattaaaagggcacgtagtcgccaacttattttttgaacccagcacacgaacgcgc
aactcctttgaaattgcggcaaaacgtttgggcgccatggttcttaaccctaatcttaaa
atttcggcaataagtaaaggtgaaactctttttgatacgattaaaactttggaagcgatg
ggtgtttattttttcattgtacgccattctgaaaatgaaaccccggagcagatagcaaaa
caattatcctcaggcgtcgtcatcaacgcgggtgacggtaatcaccaacatccctcacaa
gctttaattgatttaatgacaataaagcaacacaaaccccattggaataaattgtgcgtc
acgattattggcgatattcgtcattctcgcgtggcaaactcattaatggacggcttagtc
acgatgggcgttccggaaattcgattggtaggcccatcgtcattattgccggacaaggtc
gggaacgactcgattaaaaaattcaccgaattaaaaccaagtctccttaacagcgacgtt
attgtcacccttcgtttgcaaaaggaacgccatgataattctgtcgatatcgatgctttt
cgcggatcttttcgattgacacctgaaaaattatattccgcaaaacccgatgccattgtt
atgcatccgggtcccgtcaaccgcgaagtcgaaattaattctgatgtcgcagataaccaa
caatctgtcatccttcaacaagtacgtaacggcgtcgctatgcggatggctgtgttggaa
ttatttttgttgcgagattttcgatttttttga

DBGET integrated database retrieval system