KEGG   Clostridium botulinum A Hall: CLC_3126
Entry
CLC_3126          CDS       T00575                                 

Symbol
pfl
Name
(RefSeq) formate acetyltransferase 1
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00620  Pyruvate metabolism
cbh00640  Propanoate metabolism
cbh00650  Butanoate metabolism
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLC_3126 (pfl)
   00640 Propanoate metabolism
    CLC_3126 (pfl)
   00650 Butanoate metabolism
    CLC_3126 (pfl)
Enzymes [BR:cbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CLC_3126 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 DUF6440
Other DBs
NCBI-GeneID: 5401090
NCBI-ProteinID: YP_001388945
UniProt: A5I6U5
Position
complement(3297198..3299426)
AA seq 742 aa
MFYDSWKKFNEGSWENNINVREFIQNNYTPYYGDHSFLKESTEKTKDLWKQCETLIAEEI
KKGILDVDLDNISAINAFDAGYIDKDNETIVGLQTDKPLKRIINPFGGIRMVKQALEAYD
YKLNPHIKDIFTKYRKTHNDGVFDAYTEEMRKARSAGLLTGLPDAYGRGRIIGDYRRIPL
YGVDFLIKNKEEDLKAVKGEMNETTIRKREEISEQIKALIAMKEMALKYGIDISKPAKNA
EEAVQFLYFGYLAGVKENNGAAMSLGRVSSFIDIYIERDLKQGILTEETAQEIIDQFVIK
LRLVRHLRTPEYNDLFAGDPNWITEAIGGMGLNGETLVTKTSYRFLNTLNNLGPAPEPNM
TILWSQNLPENFKKFCAEMSIKTDSIQYENDDLMRDIYGDDYGIACCVSAMALGKQMQFF
GARCNLAKALLYSINGGVDEKKNIKVIDNINAIEDTMLDYEKVKENYFKVLEYIANLYVN
TMNIIHYMHDKYAYEGGLMALHDTEVERLMAFGVAGLSVVADSLSAIKYAKVKPVRENGI
AVDFEIEGDFPKYGNDDDRVDEIAVEIVNKFINELKKNKTYRNAKHTLSVLTITSNVVYG
KKTGSTPDGRKSGEAFAPGANPMHGRDKNGALASLNSVAKIPYKNICEDGVSNTFSIVPD
ALGKSEEERINNLVSILDGYFVQNAHHLNVNVLNRDLLIDAMEHPEKYPSLTIRVSGYAV
HFNRLTKAQQLEVISRTFHKDM
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgttttatgattcatggaaaaaatttaatgaaggttcatgggaaaataatataaatgta
agagagtttatacaaaataattatacgccttattatggagatcatagctttttaaaggaa
tctactgaaaaaacgaaagatctttggaaacaatgcgaaacattaatagcagaagaaata
aaaaaaggaatattagatgtagatttagataatatttctgctataaatgcttttgatgca
ggatatatagacaaggataatgaaaccatagtaggtcttcagacagataaaccactaaaa
agaattataaatccttttggtggtataagaatggtaaaacaagctttagaagcctatgat
tataagttaaacccacacataaaggatatatttaccaaatatagaaaaacccataatgat
ggtgtttttgatgcttatactgaagagatgagaaaagccagaagtgcaggattattaaca
gggcttccagatgcctatggaagagggagaataataggtgattatagaagaataccatta
tatggggtagattttttaataaaaaataaagaagaagatttaaaagctgttaaaggggaa
atgaatgaaactaccataagaaaaagagaagagataagcgaacaaataaaagctttaata
gctatgaaagaaatggcactaaagtatggaatagacataagcaagccagctaaaaatgca
gaagaagcagtacaatttttatattttggttatttagcaggagttaaagaaaataatgga
gcagcgatgtccttaggaagagtaagttcatttatagatatatatatagaaagagacttg
aaacagggaatactaacagaagaaacagcgcaagaaattatagatcagtttgttataaaa
ttaagattagtaagacatcttagaacaccagagtataatgatctttttgcaggagatcct
aactggattacagaagctatagggggaatgggattaaatggggagactttagttactaaa
acatcctatagattcttaaatactttaaataatttaggaccagcaccagaacctaatatg
acgatattatggtcacaaaacttaccagaaaactttaaaaaattctgtgcagaaatgtct
ataaagacagattctattcaatatgaaaatgacgatttaatgagagatatatatggagat
gattatggtatagcttgttgtgtatcagctatggccttgggaaaacagatgcaatttttc
ggtgcaagatgcaatttagccaaagctttattgtattccataaatggtggagtagatgaa
aagaagaatattaaagtaatagacaatataaatgcaatagaagatactatgttagattat
gaaaaagttaaggaaaattattttaaagtattagaatatatagcaaatttatatgtaaat
actatgaatataatacattatatgcatgataagtatgcttatgaaggtgggcttatggca
cttcatgatacagaagtagaaagacttatggcctttggtgtagctggattgtctgttgta
gcagattcattaagtgctataaaatatgcaaaagtgaaaccagtaagagaaaatggtatt
gctgtagattttgaaatagaaggagatttccctaaatacggtaatgatgatgatagagtt
gatgaaatagcagtggaaatagttaataaatttattaatgaattaaagaaaaataaaact
tatagaaatgcaaaacatacactttcagttttaacaataacttctaatgtagtgtatggt
aagaaaacaggttcaacaccagatggaagaaaatcaggagaagcatttgctccaggtgct
aatcctatgcatggaagagataaaaatggtgctttagcatcattaaattctgtagctaaa
ataccttacaaaaatatttgtgaagatggagtatcaaatacattttctatagttccagat
gcattaggtaaaagtgaagaagaaagaataaataatttagtatctatattagatggatat
tttgtacaaaatgctcatcatttaaatgttaatgtgttaaacagagatctactaatagat
gcaatggaacatccagaaaaatatccatcacttactataagggtatcaggttatgcagtt
cattttaatagattgactaaagcacaacaattagaagtgataagcagaactttccataaa
gacatgtaa

DBGET integrated database retrieval system