KEGG   Clostridium botulinum A Hall: CLC_0994Help
Entry
CLC_0994          CDS       T00575                                 

Gene name
cbiT
Definition
(RefSeq) precorrin-6Y C5,15-methyltransferase subunit CbiT
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00860  Porphyrin and chlorophyll metabolism
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLC_0994 (cbiT)
Enzymes [BR:cbh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     CLC_0994 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 MTS Cons_hypoth95 Methyltransf_25 Methyltr_RsmB-F RrnaAD PCMT Methyltransf_4 PrmA GidB Methyltransf_18 Methyltransf_3 Ubie_methyltran Met_10 DOT1 Methyltransf_11 Methyltransf_16 Methyltransf_15 Methyltransf_12 GCD14 TehB DREV DUF938 Fibrillarin CMAS Methyltransf_23 PRMT5 DNA_methylase Methyltransf_32 FtsJ
Motif
Other DBs
NCBI-GeneID: 5401763
NCBI-ProteinID: YP_001386862
UniProt: A5I0D1
Position
1016247..1016822
Genome map
AA seq 191 aa AA seqDB search
MRYIKDEEFIRGSCPMTKEDIRILSISKMNLEENSKVLDVGAGTGSVSIQAATICAKGQV
FAIEKDEEALDIIKKNKEKFNCKNLKIIEGEALKVEESIKDSFDSIFIGGSGGGLEEIIS
RYGNKLLDQGTMVLNFITINNLNTALETLKNLNYKTECIQVSISKARGKSNMLIANNPIF
IITAIKNGGNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagatatataaaggatgaagaatttataaggggaagttgtcctatgactaaagaggac
ataagaattttatccatatcaaagatgaacttagaagaaaattcaaaggttttagatgtg
ggtgcaggtacaggaagtgtaagtatacaagcagctacaatatgtgcaaaaggacaagtt
tttgccatagaaaaagatgaggaagccttagacattataaaaaaaaataaagaaaaattt
aattgtaaaaatctaaagataatagagggagaagccttaaaagtagaagaaagtataaag
gatagttttgatagtatatttataggtggtagcggtggaggtctggaagaaataataagt
agatatgggaacaagcttttagaccaaggcacaatggttttaaattttataaccataaac
aatttaaatacggcgttagaaaccttaaaaaatttaaattataaaacagaatgtattcaa
gtttctataagtaaagctagaggaaagtcaaatatgcttattgctaataatcctatattt
ataataacagctattaaaaatggagggaatttataa

DBGET integrated database retrieval system