KEGG   Clostridium botulinum A Hall: CLC_1007
Entry
CLC_1007          CDS       T00575                                 

Name
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB
Motif
Pfam: ECF_trnsprt ECF-ribofla_trS TMEM174 5TM-5TMR_LYT DUF3810
Other DBs
NCBI-GeneID: 5401775
NCBI-ProteinID: YP_001386875
UniProt: A5I0E4
Position
1025091..1025579
AA seq 162 aa
MKTKRLVIMGLFIALSFVGANIKIMGSIAFDSMPAFLGTLILGPIMGAIIGAVAHFLSAL
TSGFPLSLPVHMIVMVDMAVTMILFGIVYNKFKNKNNILAAIVATVVAVIINGPVSVFAI
IPIAGKGVLALLPILSLAALANVIIAIIIYRFIPEKYFQRDK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaaactaaaagattagttattatgggattatttatagctttaagttttgtaggtgca
aatataaaaataatgggaagtatagcctttgattctatgccagcatttttaggaacatta
atattaggacctattatgggggccattataggggcagtagctcactttttaagtgcctta
actagtggattcccattaagtttaccagtacatatgatagttatggtagatatggcagta
acaatgatattatttggaatagtttataataaatttaaaaataaaaataatattttagca
gctatagttgcaacagtagtggcagttattataaatggaccagtatctgtgtttgctata
attcctatagcaggtaaaggagtattagctctattaccaatactttctttagcagcttta
gcaaatgtaataatagctattataatatatagatttatacctgaaaaatattttcagaga
gacaaataa

DBGET integrated database retrieval system