KEGG   Clostridium botulinum A Hall: CLC_1325
Entry
CLC_1325          CDS       T00575                                 

Definition
(RefSeq) xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00230  Purine metabolism
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLC_1325
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-GeneID: 5401027
NCBI-ProteinID: YP_001387191
UniProt: A5I1C4
Position
1368541..1369014
AA seq 157 aa
MSLKRKIKLTVNDKKYEIEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KNYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaacttacagttaatgataaaaagtatgaaatagaaata
gatattagagaatctttatcagaagtattaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgaggga
gtacaaaaaaatggtgagctttcagaggttcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagcgaa
aaaaactatactgatgatgaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaagaaaataa

DBGET integrated database retrieval system