KEGG   Clostridium botulinum A Hall: CLC_1664Help
Entry
CLC_1664          CDS       T00575                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00260  Glycine, serine and threonine metabolism
cbh00750  Vitamin B6 metabolism
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01230  Biosynthesis of amino acids
Module
cbh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLC_1664 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLC_1664 (thrC)
Enzymes [BR:cbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLC_1664 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP MtrB_PioB
Motif
Other DBs
NCBI-GeneID: 5398411
NCBI-ProteinID: YP_001387521
UniProt: A5I2A8
Position
1749896..1751377
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELKNMNYKELAFYIMKK
YFDDFNEEELKECIDKAYDSKFENPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKTSAKKMNITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIDGNFDDAQSGVKEIFNDRDFNGLLEERGYMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGENINIVVPTGNFGNILAAFYAKNMGIPVGRLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSRLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAIEKVYESSDYLIDTHTAVAYDVYEKYKNKTGDNSATIIA
STASPFKFPKSINEVLDMGHENASDFELVNLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactaggggagaagggaaaaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agttttaaagaattaaaaaacatgaattataaggaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagataaagcctatgacagt
aagtttgagaatcctcttatagcaccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggctttaagtatacttccgcacctt
ttaaaaacctcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagagggcacaaagata
gtggtattttatcctaaggatggggtaagtgaaattcaaaaaagacagatggttacacaa
gaggggaagaatactttcgtagtaggcatagatgggaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgatagagattttaatggattattagaggaaaggggatacatg
ttttcctctgctaattctataaatataggaagactagtaccgcaaatagtatactatgtt
tattcttatgtgaatctacttaaagataaaaaagtaggggaaggagaaaatataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaagattaatttgtgcatctaatgagaataaggtgctaacagattttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcacgc
cttataaaaaatctcatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcggatgaagatgatacacttaaa
gctattgaaaaagtctatgaaagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaacaggagataatagtgctactataatagca
tctaccgcaagtccatttaaatttcccaaaagtataaatgaagtattagatatgggacat
gaaaatgcttcagattttgaattagttaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system