KEGG   Clostridium botulinum A Hall: CLC_1682Help
Entry
CLC_1682          CDS       T00575                                 

Definition
(RefSeq) Fis family transcriptional regulator
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_8 DUF3699 PARP_reg
Motif
Other DBs
NCBI-GeneID: 5400253
NCBI-ProteinID: YP_008472688
Position
1770153..1770440
Genome map
AA seq 95 aa AA seqDB search
MFGFIKIDKLEEYDLPGNVRELRNVVERDYYLSDTGTVSPHYIEKNIFLETNNEDHGNKD
INIIPMGKLEKENIENAIEKCDGNLARAARLLNIG
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggttttataaaaatagataaattagaggagtatgatttgccaggtaatgtaaga
gagcttagaaatgtggtagaaagagattattatttaagcgatacaggcacagtttcacct
cactatattgaaaaaaatatatttttagaaaccaataatgaggatcatggaaataaggat
ataaatattattcccatgggaaagttggaaaaggaaaatattgaaaatgctatagaaaaa
tgtgatggaaacttggctagagcagcaaggctattgaatattggttga

DBGET integrated database retrieval system