KEGG   Clostridium botulinum A Hall: CLC_1684Help
Entry
CLC_1684          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hemerythrin Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 5401629
NCBI-ProteinID: YP_001387540
UniProt: A5I2C7
Position
1771606..1772160
Genome map
AA seq 184 aa AA seqDB search
MNSIELMVNEHKNIKHMLVVIRKYCFKVLKNEQVDYNDFYKIINFVRNYADKHHHGKEED
YLFNRMIEEIKGPTEKLVKQGMLVEHDLGRLYMQNLEKALKALENGEEEAKIDIIANAVS
YTDLLYRHIEKEDDVVYKFAERNLSKETLKKLDEDCERIEKEAREKGIQDKYKNLIHELE
EKVK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaattgaacttatggtaaatgaacataagaatataaagcatatgttagttgtt
ataaggaagtattgttttaaagtattaaaaaatgaacaggtagattataatgatttttat
aaaataattaattttgtaagaaattatgcagataagcatcatcatggaaaagaggaagat
tatctatttaatagaatgattgaggagattaagggccctacagaaaaattagtaaaacaa
ggtatgttagtggagcatgatcttggaagattatatatgcaaaatttagaaaaggctctt
aaagctttagaaaatggtgaagaggaggctaaaatagacataatagctaacgcagtttca
tatacagatttattgtatagacatatagaaaaagaagatgatgtagtttataaatttgca
gaaagaaatctatctaaagaaactttaaaaaaattagatgaggactgtgaaagaattgaa
aaggaagctagagaaaaaggaatacaagataaatataaaaatcttattcatgaacttgag
gaaaaggttaaataa

DBGET integrated database retrieval system