KEGG   Clostridium botulinum A Hall: CLC_1686Help
Entry
CLC_1686          CDS       T00575                                 

Definition
(RefSeq) methyl-accepting chemotaxis protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal CZB Baculo_PEP_C BLOC1_2 GP24_25 Serine_rich Cbl_N
Motif
Other DBs
NCBI-GeneID: 5399238
NCBI-ProteinID: YP_001387542
UniProt: A5I2C9
Position
1774188..1775660
Genome map
AA seq 490 aa AA seqDB search
MRIFKDNAIEKEIIKISQDFQNQNVHALDEIEGSASKNRMVRFTAGIAKIVQVISPKVKK
LINGVLSITTRISTFSVNLDYSGEHLKKSADKLYNSSGVLNSSIKEVKEAMQQITLAIEE
DVETVEHISSGNIELIKYMDENKKNLGLVKNVNKELEFKAQSMEKDMTELNSILENMKTI
VTGMSEIASKTNLLALNASIEAARAGEAGKGFAVVAEEVRKLSESTSKQLEKMEEFVNNI
GTCSTNSSKSVKDTIGSIGELGEYTQAISSSSSKVREAIDIEVKSIELLAASMQEINASS
EEINSNMDIIGENVQEVSKEAAVLSEKSLEIKYLADEMDKIDDEVSNLAKLSGDITGENY
FKITNKDFIVAIDNAIKAHENWVQQLQNMAMENKIKPIQTDGQKCGFGHFYNSVMPRNEK
IKEIWIKIDDIHKELHKVGGIVKSNIKDGHTEKAKENSKKATQLSQTIISMLSHIKSIAI
ETDKEGNLVL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttgagaatatttaaagataatgccattgaaaaggaaataataaaaatatcacaggatttt
caaaatcaaaatgtacatgctctagatgaaatagaagggtctgcaagtaaaaatagaatg
gtaagatttactgcaggtatagctaaaatagtacaagttatatctcctaaggtaaaaaaa
ttgataaatggagtattatcaattactactagaataagtactttttccgtaaacttagat
tattctggagagcatcttaaaaaatcagcagataagttatataattcttccggagttcta
aactcatctattaaagaagtaaaagaggctatgcagcagataactttagctattgaagag
gatgtagaaaccgttgagcacataagtagtggtaatatagaactaataaaatatatggat
gaaaataaaaagaatttaggtcttgtgaaaaatgtaaataaagaattggaatttaaggct
caatctatggagaaagatatgacagaattaaattctatactagaaaacatgaaaactata
gttactggtatgagtgaaatagcatcaaaaactaatctattagccttaaatgctagcata
gaagctgcaagagcaggagaggcagggaagggctttgctgttgtagcggaggaagttaga
aaactttctgaaagcacatcaaaacaactagagaagatggaggaatttgtcaacaatata
gggacttgctctactaatagtagtaaaagtgtaaaggatactataggaagtataggtgaa
ctaggggaatatacacaagctatatcttcgtcctcttctaaagttagagaagctatagat
attgaagtaaagagtatagaacttctggctgctagtatgcaagaaataaatgcttcaagt
gaagaaataaatagtaatatggatatcataggtgaaaatgtacaggaagtaagtaaagaa
gctgctgttttaagtgaaaaatctttagaaataaaatatctagcagatgaaatggataaa
atagatgatgaagtatctaatttggctaaactaagtggtgatataactggggaaaattac
tttaaaattacaaataaagattttattgtggctatagacaatgctataaaagcacatgaa
aattgggtacaacaactccaaaatatggctatggaaaataaaataaaaccaatacaaaca
gatggacaaaaatgtggatttggtcatttttataattctgtaatgccaagaaatgagaag
ataaaagaaatttggattaaaatagatgatatacataaagaattacataaagtaggggga
attgtaaaaagtaatataaaggatggacatacagagaaagctaaagaaaatagtaaaaaa
gctacacagttgtcacaaacaattataagtatgttgtctcatataaaatcaattgctata
gaaactgataaggaaggtaatttggttctttaa

DBGET integrated database retrieval system