KEGG   Clostridium botulinum A Hall: CLC_1687Help
Entry
CLC_1687          CDS       T00575                                 

Definition
(RefSeq) xanthine/uracil permease
  KO
K06901  putative MFS transporter, AGZA family, xanthine/uracil permease
Organism
cbh  Clostridium botulinum A Hall
Brite
Transporters [BR:cbh02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Purine transporter (AzgA) family [TC:2.A.1.40]
    CLC_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-GeneID: 5398400
NCBI-ProteinID: YP_001387543
Position
1775748..1777088
Genome map
AA seq 446 aa AA seqDB search
MGGRGIKEKDEGEVENKFNSLFNIKKYNTTVKGEILAGFTSFFAIVYIIAVNASILSDAG
LPLEGAIIATVLSSFVGCILVGVISNAPLILVPGMGVNALFSYTIVGSMGLSWQQALAAV
FVSGVVFSIIAFTRFSKTLIESIPTSLKEAITVGIGVLITFIGLQKSGIVIGSTTTFVAL
GNFNNPLVYVTFINLIITLILFIKNVPGNFLISMIVGTIISYFLGLIDMAKLTFSNFSLG
AYKEVFFKMDFSSATSITFWIAVFSLTLVLVFENLGLLHAHINVMLKEENKFKTSFKACS
LSAITCGFFGTSPTVATIETAAGITAGGKTGLTSIFTGILFLLSLFLLPIIKIIPNSAIS
PILIVIGGLMIKNILSINFNDFSEGFPAFLIIVMIPLTFSIVDGMAFGFICYPIVKLAGK
KSKEISYAMYIISLMFLLNFILHAVS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgggagagggataaaagaaaaggacgaaggagaagtggaaaataaatttaatagt
ttattcaatattaagaagtataatactacagtcaaaggagaaatattagcaggttttacc
tcattttttgcaattgtatatataattgctgtaaatgcatctatattatccgatgcaggt
ttgcctttagaaggagcaataatagctacagtactatcctcatttgtaggatgtatatta
gttggagtcataagtaatgcaccactaattttagttccaggcatgggagttaatgctctt
ttttcctatactattgtaggttctatggggctttcatggcagcaagcattagcagcggta
tttgtatcaggagttgtattttccataatagcttttacaaggttttctaaaaccctcata
gaatcaatcccaacttccttaaaggaagctataactgtgggaattggtgttttaattaca
tttataggattacaaaaaagtgggattgtaataggaagtacgacaacttttgttgcatta
ggaaattttaataatccactagtatatgtaacttttattaatttaataattacattaata
ttatttataaaaaatgtgccaggaaattttttaataagcatgattgttggaacgattata
tcatattttttgggacttatagatatggcaaagcttactttttcaaatttttcattaggc
gcttataaagaggttttctttaaaatggattttagtagcgctacttccataaccttttgg
atagcagtattttcattaacgctagtacttgtatttgaaaatttagggcttttacatgct
catataaatgttatgttaaaggaagaaaataaatttaaaacttcttttaaagcttgttcg
ctatctgctattacttgtggattttttggaacgagtcctacagtagctactatagaaact
gcagctgggataactgcaggaggaaaaactggattaacatctatttttacaggaatttta
tttttattatcattatttttacttccaattataaaaatcatacctaatagtgctatttca
cctatacttattgttataggaggattaatgataaaaaatatattaagtattaattttaat
gatttttcagaaggttttcctgcttttttaattatagttatgattccactaacttttagt
attgtagatggtatggcttttggatttatttgctatccgattgtaaagttagcgggaaaa
aaatcaaaagaaatttcttatgcaatgtatataatttcacttatgttcttgttaaatttt
atattacatgcagtaagctga

DBGET integrated database retrieval system