KEGG   Clostridium botulinum A Hall: CLC_1689Help
Entry
CLC_1689          CDS       T00575                                 

Definition
(RefSeq) short chain dehydrogenase/reductase oxidoreductase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd DUF1776 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 5398916
NCBI-ProteinID: YP_001387545
UniProt: A5I2D2
Position
complement(1778378..1779262)
Genome map
AA seq 294 aa AA seqDB search
MNEDLNFINSFPKSVPGQEQSKQPGIEAIMNPKPIFDNPNYKASAKLMDRVALITGGDSG
IGRAVAVTFAKEGADISIVYFDEHEDAKETQAIIEGLGRKCLLIPGDITDDNFCNNAINQ
TINTFNKLDILVNNAAVQYVQNSIEDITKEQLEKTFKTNIFSMFYLVKAALPYLNRGASI
INTASITAYKGQKLLIDYSSSKGAIVSFTRSLALSLWSKGIRVNAVAPGPIWTPLIPSSF
DTNHVETFGSTTTMGRPGQPVELAPAYVYLASNECASFVSGEVIHINGGEIING
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagatttgaattttataaacagtttccctaagtctgtacctggtcaagagcaa
tcaaagcaacccggtatagaagctattatgaatcctaaacccatttttgacaatcctaac
tacaaagcttccgcaaagcttatggatagagttgccttaattaccggtggtgatagtggc
attggtagagctgtagctgtaacctttgctaaagaaggtgcagacatttctattgtatac
tttgatgaacacgaagatgcaaaggaaactcaggctataatagaaggtttaggtagaaag
tgtttattaattcctggagatattacagatgataacttttgcaataatgccataaatcaa
actataaatacttttaataaactagatattttagtaaacaatgcagctgttcaatacgtt
caaaatagcatagaggatataacaaaggaacaattagaaaaaacttttaaaactaatata
ttcagtatgttctatttagtaaaggctgctttaccctatttaaacagaggtgcttccatt
ataaatacagcatctataacagcctataaaggtcaaaagctgttaattgattattcttct
agtaagggtgctattgtaagctttactcgctctttggcattatctttatggagtaaaggt
ataagagttaatgccgtagcccctggacctatttggactcctcttataccttcttccttt
gatactaatcatgtagaaacatttggttctaccacaactatgggcagaccaggtcagcca
gtagaattagctccagcctatgtatacttagcctctaatgaatgtgcctcctttgtatct
ggtgaagtaatacatataaatggaggagaaattataaacgggtag

DBGET integrated database retrieval system