KEGG   Clostridium botulinum A Hall: CLC_1695Help
Entry
CLC_1695          CDS       T00575                                 

Definition
(RefSeq) formylmethanofuran dehydrogenase E subunit-like protein
  KO
K11261  formylmethanofuran dehydrogenase subunit E [EC:1.2.7.12]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00680  Methane metabolism
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
cbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    CLC_1695
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.12  formylmethanofuran dehydrogenase
     CLC_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdE zf-dskA_traR DUF4428 LIM Prok-RING_2 zf-RRN7
Motif
Other DBs
NCBI-GeneID: 5399370
NCBI-ProteinID: YP_001387551
UniProt: A5I2E2
Position
1788905..1789429
Genome map
AA seq 174 aa AA seqDB search
MKEGLWERCTNFHGHSCPGLAIGYKAVEAAIETMNIKFSEDEEIVCVTENDACGVDAIQV
LLGCSLGKGNIIHKDSGKMAFSFFNRKNEESIRMIFSPKEKMEDRNEYMNYILNADYKEL
FQFKKPNYFLPERARLFKNITCEICNESTAEHRVRIMDGKMVCSDCFKEYSRVL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggattatgggaaagatgtacaaattttcatgggcattcttgtccaggacta
gccataggctacaaagctgtagaggcagctatagaaactatgaatataaaattttcagag
gatgaagaaatagtttgtgtaacagaaaatgatgcctgtggagtagatgcaatacaagtg
ctattaggttgctctttaggaaaaggtaatattattcataaggattctggaaagatggct
ttctctttttttaatagaaaaaatgaagagtcaataagaatgatatttagtcctaaggaa
aaaatggaagatagaaatgaatatatgaattacatattaaatgcggattataaggaactc
tttcaattcaaaaaacctaattattttttaccagaaagagctagattatttaaaaatatt
acttgcgaaatctgtaacgaaagcactgcagaacatagagttagaataatggatggaaaa
atggtttgttctgattgctttaaggaatattcaagagttctttag

DBGET integrated database retrieval system