KEGG   Clostridium botulinum A Hall: CLC_1696Help
Entry
CLC_1696          CDS       T00575                                 

Definition
(RefSeq) peptide/opine/nickel uptake ABC transporter substrate-binding protein
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh02024  Quorum sensing
Module
cbh_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CLC_1696
Transporters [BR:cbh02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    CLC_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 OAD_gamma
Motif
Other DBs
NCBI-GeneID: 5398970
NCBI-ProteinID: YP_001387552
UniProt: A5I2E3
Position
1789566..1791161
Genome map
AA seq 531 aa AA seqDB search
MKTISKKSMLLVFTMLIAISFLFTGCKGGKKEAEATNANNKSEKKDVNIKLEGGDWGEPN
PYKTYPRGPGMSKTNLIYDSLIEKDEKRIIPWLAEKWEVKSNGKEYLFKIREGVKWQDGK
DFTPEDVKFTFDYYKKHPPVSKNIYIGKKCFIDKVEVLKDNYIKITVNTVNAASLENLGT
TRIIPKHIWEKVEDPKKFDGKEAFIGCGPYMLEDYNKERGSYKFTAFEDYWGPKQNVKTI
EFIPVSDSILAFEKGDIDLVGSVKPDIAKKYENNKEYKLIKGHNFFGYRLCLNMNKNPEF
KDKNVRQAIAYAIDEKEIIDKVMRGIGTEGSAAYLPKEHIWYNKDIKKYDYNVEKAKELL
KGKNITFQIIVSNKKDNLRMAELLKLQLEKTGMKVNVKSIDMKSRDAAVKSRDYEAIITE
HGGWGKDADVLRELYKSNNDKNGGSVINGIPGYKNEEIDKLCIKQMQEMDPDKRKEIVFQ
LQEKIAEEIPMIPIINTSSISVHKTDKYDGYMNMYDHFVVSHSKLTYLQRK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacgatatcaaaaaagagtatgttgttggtatttacaatgctaatagctataagc
tttttgtttacaggttgtaaaggaggtaaaaaagaggcagaagctaccaatgcaaataat
aaatcagaaaaaaaagacgtaaatattaaattagaaggtggagattggggagaaccaaat
ccatataaaacatatcctagaggaccaggaatgtccaagaccaatttaatatatgattcc
cttatagaaaaggatgaaaagagaattataccatggcttgcagaaaaatgggaggtaaaa
agcaatgggaaggaatatttatttaaaataagggaaggagtaaaatggcaagatggtaag
gactttactccagaagatgttaaatttacttttgattattataaaaaacacccaccagta
agcaaaaatatatacataggtaaaaaatgttttatagataaggtagaagtattaaaggat
aactatataaaaataacagttaatacagtaaatgcagcttctttagaaaatctaggaact
actagaataataccaaagcatatttgggaaaaggtagaggatcctaaaaaatttgatggc
aaggaagcttttataggttgtggaccatacatgctggaggattataataaagaaagaggt
tcttataaatttactgcttttgaagattattggggaccaaaacaaaatgttaaaactata
gagtttattccagtgagtgattctatacttgcctttgaaaaaggtgatatagatctagta
ggaagtgttaaaccagatatagctaaaaaatatgaaaataataaagaatataaattaata
aaaggacataacttctttggatatagattatgtttaaatatgaataaaaatccagaattt
aaggacaaaaatgtaagacaagctatagcctatgctatagatgaaaaagaaataatagat
aaagttatgagaggaataggaacagaaggaagtgcagcctatttgccaaaggaacatata
tggtataacaaagatataaaaaaatatgattataatgtagaaaaggctaaagaactttta
aagggtaaaaatataactttccaaattattgtatctaataaaaaagataatttaagaatg
gcagaacttttaaaattacaattagaaaaaacaggaatgaaagttaatgttaaaagcatt
gatatgaaaagtagagatgcagcggtaaagtcacgagattatgaagctattataactgaa
catggtggctggggtaaagatgcagatgttttaagagaactttataagtccaacaatgat
aaaaacggtggaagcgttataaatggtataccaggatataaaaatgaagaaatagataaa
ctttgtataaaacaaatgcaggagatggatccagataagagaaaagaaatagtatttcag
cttcaagaaaaaatagcagaagaaatacctatgatacctattataaatacatcttctata
tcagtgcacaaaactgataaatatgatggatatatgaatatgtatgatcattttgtggta
tctcatagtaaattaacttatttacaaaggaaataa

DBGET integrated database retrieval system