KEGG   Clostridium botulinum A Hall: CLC_1698Help
Entry
CLC_1698          CDS       T00575                                 

Definition
(RefSeq) peptide/opine/nickel uptake ABC transporter permease
  KO
K02034  peptide/nickel transport system permease protein
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh02024  Quorum sensing
Module
cbh_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLC_1698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbh02000]
    CLC_1698
Transporters [BR:cbh02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    CLC_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 5399189
NCBI-ProteinID: YP_001387554
UniProt: A5I2E5
Position
1792153..1792974
Genome map
AA seq 273 aa AA seqDB search
MKKYCKIFKKCSIIGKLSFLVAFVFIIVAILCPLLCKHSYNVPSGSALNSPSMEHILGTD
DLGIDLWSQICYGGRISITLGISTALLAGTFGSFVGIISGYYGGIIDKFLMRFTDLMLVL
PQLPVMIVLAAFFGPKLKNVIIVLSIFSWVEPARVIRSKVMSIKDENYIKAAKSYGASFL
HIFSKHILPQIFPLVSIIMVKIISKAIIVESSLSFLGLGDPVSKSWGMILNHAIDFDGIY
FTDYWKWWITVPLFSIIILVLSFAFIGKEIENF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtattgtaaaatttttaaaaaatgttctattataggtaaattatctttttta
gtagcatttgtttttataattgtagctattttatgtccactattatgtaagcattcttat
aatgtacccagtggaagtgctttaaattctccatctatggaacatattctaggtacagac
gatttaggaatagacctatggtctcagatttgttatggtggaaggataagtataacttta
ggtatatctacagctcttttagctggtacttttggtagttttgtaggaataatttcaggt
tattatggaggtataattgacaaatttctaatgagatttacagacttaatgctagtatta
ccgcagcttcctgttatgatagtccttgctgctttttttgggcctaaattaaaaaatgta
ataatagtactaagcatattttcttgggtagagcctgctagagtaataagatccaaggtt
atgtctataaaggatgaaaattatataaaagcggctaaaagttatggagcaagcttttta
catatattcagcaaacatatattgcctcaaattttcccactagtaagcattattatggta
aaaataataagtaaagcaataatagtagaatcttccctatcttttttaggattaggagat
ccagtatctaaaagctggggaatgattttaaatcatgctatagattttgatgggatatac
tttacagattattggaaatggtggattacagtacctttattttctattattattttagta
ttatcctttgcttttatagggaaagagatagaaaatttttaa

DBGET integrated database retrieval system