KEGG   Clostridium botulinum A Hall: CLC_1700Help
Entry
CLC_1700          CDS       T00575                                 

Definition
(RefSeq) DNA polymerase III subunit epsilon
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 RNase_H_2
Motif
Other DBs
NCBI-GeneID: 5399515
NCBI-ProteinID: YP_001387556
UniProt: A5I2M9
Position
complement(1794928..1795515)
Genome map
AA seq 195 aa AA seqDB search
MKKIFIDTETTGLEPGEIIQLTYCVCDINFRGEEKVSFAKNFFFDVDYIEESAEAIHGFS
VEKLKILSKGKKFKDLASEISSDLKDGIFIAHNVNFDRKFVTAEFNRLNDMNWIPKEFFC
TMEYFKPIVKATTRTGKLKKPRLEEAVDFLNIDKKIVLKGAKKLFNCDDVGFHDARYDVA
ALVSCYYRAKRLGYS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatttttatagatacagaaactacaggtttagaacctggtgaaattatacaa
cttacttattgtgtttgtgatataaattttagaggtgaagagaaagtttcctttgccaaa
aacttcttttttgatgtagattatattgaagaatctgcagaagctattcatggttttagc
gtagaaaaattaaagattttatctaaaggcaaaaaatttaaagatttggcttcagaaata
agttccgatttaaaagatgggatctttatagctcataatgtaaattttgatagaaaattt
gttaccgctgaatttaatagattaaatgatatgaattggattcctaaagaattcttctgc
accatggaatattttaaacccattgtaaaagctaccaccagaacaggtaaattaaaaaaa
cctagactagaagaagcagttgattttttaaatatagataaaaaaatagttctaaaggga
gctaaaaaactttttaactgtgatgatgttggatttcatgatgctagatatgatgtagcc
gctcttgtatcctgctattatagagctaagagattaggatattcttag

DBGET integrated database retrieval system